LOCUS AF534906 423 bp DNA linear VRL 18-AUG-2004
DEFINITION Human adenovirus type 1 subgroup C, complete genome.
ACCESSION AF534906 REGION: 3621..4043
VERSION AF534906.1 GI:33330439
KEYWORDS .
SOURCE Human adenovirus 1
 ORGANISM Human adenovirus 1
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 423)
 AUTHORS Lauer,K.P., Llorente,I., Blair,E., Seto,J., Krasnov,V.,
 Purkayastha,A., Ditty,S.E., Hadfield,T.L., Buck,C., Tibbetts,C. and
 Seto,D.
 TITLE Natural variation among human adenoviruses: genome sequence and
 annotation of human adenovirus serotype 1
 JOURNAL J. Gen. Virol. 85 (Pt 9), 2615-2625 (2004)
 PUBMED 15302955
REFERENCE 2 (bases 1 to 423)
 AUTHORS Seto,D.
 TITLE Direct Submission
 JOURNAL Submitted (06-AUG-2002) Biomedical Genomics and Informatics, George
 Mason University, 10900 University Blvd, Manassas, VA 20110, USA
FEATURES Location/Qualifiers
 source 1..423
 /organism="Human adenovirus 1"
 /virion
  /mol_type="genomic DNA"
 /db_xref="taxon:10533"
 /note="subgroup: C"
 gene 1..423
 /gene="IX"
  CDS 1..423
 /gene="IX"
 /codon_start=1
 /product="hexon-associated protein 14.5 kDa"
 /protein_id="AAQ10541.1"
 /db_xref="GI:33330443"
 /translation="MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANS
 TTLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTA
 LLAQLDSLTRELNVVSQQLLELRQQVSALKASSPPNAV"
ORIGIN 
 1 atgagcacca actcgtttga tggaagcatt gtgagctcat atttgacaac gcgcatgccc
 61 ccatgggccg gggtgcgtca gaatgtgatg ggctccagca ttgatggtcg ccccgtcctg
 121 cccgcaaact ctactacctt gacctacgag accgtgtctg gaacgccgtt ggagactgca
 181 gcctccgccg ccgcttcagc cgctgcagcc accgcccgcg ggattgtgac tgactttgct
 241 ttcctgagcc cgcttgcaag cagtgcagct tcccgttcat ccgcccgcga tgacaagttg
 301 acggctcttt tggcacaatt ggattctttg acccgggaac ttaatgtcgt ttctcagcag
 361 ctgttggagc tgcgccagca ggtttctgcc ctgaaggctt cctcccctcc caatgcggtt
 421 taa
//