LOCUS AF534906 1107 bp DNA linear VRL 18-AUG-2004
DEFINITION Human adenovirus type 1 subgroup C, complete genome.
ACCESSION AF534906 REGION: 16563..17669
VERSION AF534906.1 GI:33330439
KEYWORDS .
SOURCE Human adenovirus 1
 ORGANISM Human adenovirus 1
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 1107)
 AUTHORS Lauer,K.P., Llorente,I., Blair,E., Seto,J., Krasnov,V.,
 Purkayastha,A., Ditty,S.E., Hadfield,T.L., Buck,C., Tibbetts,C. and
 Seto,D.
 TITLE Natural variation among human adenoviruses: genome sequence and
 annotation of human adenovirus serotype 1
 JOURNAL J. Gen. Virol. 85 (Pt 9), 2615-2625 (2004)
 PUBMED 15302955
REFERENCE 2 (bases 1 to 1107)
 AUTHORS Seto,D.
 TITLE Direct Submission
 JOURNAL Submitted (06-AUG-2002) Biomedical Genomics and Informatics, George
 Mason University, 10900 University Blvd, Manassas, VA 20110, USA
FEATURES Location/Qualifiers
 source 1..1107
 /organism="Human adenovirus 1"
 /virion
  /mol_type="genomic DNA"
 /db_xref="taxon:10533"
 /note="subgroup: C"
 gene <1..>1107
 /gene="L3_1"
 gene 1..1107
 /gene="pV"
 CDS 1..1107
 /gene="pV"
 /codon_start=1
 /product="minor core protein 42 kDa"
 /protein_id="AAQ10550.1"
 /db_xref="GI:33330452"
 /translation="MSKRKIKEEMLQVIAPEIYGPPKKEEQDYKPRKLKRVKKKKKDD
 DDELDDEVELLHATAPRRRVQWKGRRVRRVLRPGTTVVFTPGERSTRTYKRVYDEVYG
 DEDLLEQANERLGEFAYGKRHKDMLALPLDEGNPTPSLKPVTLQQVLPALAPSEEKRG
 LKRESGDLAPTVQLMVPKRQRLEDVLEKMTVEPGLEPEVRVRPIKQVAPGLGVQTVDV
 QIPTTSSTSIATATEGMETQTSPVASAVADAAVQAAAAAASKTSTEVQTDPWMFRVSA
 PRRPRRSRKYGAASALLPEYALHPSIAPTPGYRGYTYRPRRRATTRRRITTGTRRRRR
 RRQPVLAPISVRRVAREGGRTLVLPTARYHPSIV"
ORIGIN 
 1 atgtccaagc gcaaaatcaa agaagagatg ctccaggtca tcgcgccgga gatctatggc
 61 cccccgaaga aggaagagca ggattacaag ccccgaaagc taaagcgggt caaaaagaaa
 121 aagaaagatg atgatgatga acttgacgac gaggtggaac tgttgcacgc gaccgcgccc
 181 aggcggcggg tacagtggaa aggtcgacgc gtaagacgtg ttttgcgacc cggcaccacc
 241 gtagtcttta cgcccggtga gcgctccacc cgcacctaca agcgcgtgta tgatgaggtg
 301 tacggcgacg aggacctgct tgagcaggcc aacgagcgcc tcggggagtt tgcctacgga
 361 aagcggcata aggacatgct ggcgttgccg ctggacgagg gcaacccaac acctagccta
 421 aagcccgtga cactgcagca ggtgctgccc gcgcttgcac cgtccgaaga aaagcgcggc
 481 ctaaagcgcg agtctggtga cttggcgccc accgtgcagc tcatggtgcc caagcgccaa
 541 cgactggaag atgtcttgga aaaaatgacc gtggagcctg ggctggagcc cgaggtccgc
 601 gtgcgaccaa tcaagcaggt ggcaccggga ctgggcgtgc agaccgtgga cgttcagata
 661 cccaccacca gtagcactag tattgccact gccacagagg gcatggagac acaaacgtcc
 721 ccggtcgcct cggcggtggc agatgccgcg gtgcaggcgg ccgctgcggc cgcgtccaaa
 781 acctctacgg aggtgcaaac ggacccgtgg atgtttcgcg tttcagcccc ccggcgtccg
 841 cgccgttcga ggaagtacgg cgccgccagc gcgctactgc ccgaatatgc cctacatcct
 901 tccatcgcgc ctacccccgg ctatcgtggc tacacctacc gccccagaag acgagcaact
 961 acccgacgcc gaatcaccac tggaacccgc cgccgccgtc gccgtcgcca gcccgtgctg
 1021 gccccgattt ccgtgcgcag ggtggctcgc gaaggaggca ggaccctggt gctgccaaca
 1081 gcgcgctacc accccagcat cgtttaa
//