LOCUS       AF534906                 753 bp    DNA     linear   VRL 18-AUG-2004
DEFINITION  Human adenovirus type 1 subgroup C, complete genome.
ACCESSION   AF534906 REGION: 18022..18774
VERSION     AF534906.1  GI:33330439
KEYWORDS    .
SOURCE      Human adenovirus 1
  ORGANISM  Human adenovirus 1
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            Human adenovirus C.
REFERENCE   1  (bases 1 to 753)
  AUTHORS   Lauer,K.P., Llorente,I., Blair,E., Seto,J., Krasnov,V.,
            Purkayastha,A., Ditty,S.E., Hadfield,T.L., Buck,C., Tibbetts,C. and
            Seto,D.
  TITLE     Natural variation among human adenoviruses: genome sequence and
            annotation of human adenovirus serotype 1
  JOURNAL   J. Gen. Virol. 85 (Pt 9), 2615-2625 (2004)
   PUBMED   15302955
REFERENCE   2  (bases 1 to 753)
  AUTHORS   Seto,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2002) Biomedical Genomics and Informatics, George
            Mason University, 10900 University Blvd, Manassas, VA 20110, USA
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Human adenovirus 1"
                     /virion
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10533"
                     /note="subgroup: C"
     gene            <1..>753
                     /gene="L3_1"
     gene            1..753
                     /gene="pVI"
     CDS             1..753
                     /gene="pVI"
                     /codon_start=1
                     /product="hexon-associated protein 27 kDa precursor"
                     /protein_id="AAQ10552.1"
                     /db_xref="GI:33330454"
                     /translation="MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGI
                     KNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQNK
                     INSKLDPRPPVEEPPPAVETVLPDGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLP
                     TTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPSAVVVTRPSRASLRRAASGP
                     RSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF"
ORIGIN      
        1 atggaagaca tcaactttgc gtctctggcc ccgcgacacg gctcgcgccc gttcatggga
       61 aactggcaag atatcggcac cagcaatatg agcggtggcg ccttcagctg gggctcgctg
      121 tggagcggca ttaaaaattt cggttccacc gttaagaact atggcagcaa ggcctggaac
      181 agcagcacag gccaaatgct gagggacaag ttgaaagagc aaaatttcca acaaaaggtg
      241 gtagatggcc tggcctctgg cattagcggg gtggtggacc tggccaacca ggcagtgcaa
      301 aataagatta acagtaagct tgatccccgc cctcccgtag aggagcctcc accggccgtg
      361 gagacagtgt tgccagatgg gcgtggcgaa aagcgcccgc gccccgacag ggaagagact
      421 ctggtgacac aaatcgacga gcctccctcg tacgaggagg cgctaaagca aggcctgccc
      481 accacccgtc ccatcgcgcc catggctacc ggagtgttgg gccagcacac acctgtaacg
      541 ctggacctgc ctccccccgc tgacacccag cagaaacctg tgctgccagg gccgtccgcc
      601 gttgttgtaa cccgccctag ccgcgcgtcc ctgcgccgtg ccgccagcgg tccgcgatcg
      661 ttgcggcccg tagccagtgg caactggcaa agcacactga acagcatcgt gggtctgggg
      721 gtgcaatccc taaagcgccg acgatgcttt tga
//