LOCUS AF534906 684 bp DNA linear VRL 18-AUG-2004
DEFINITION Human adenovirus type 1 subgroup C, complete genome.
ACCESSION AF534906 REGION: 27225..27908
VERSION AF534906.1 GI:33330439
KEYWORDS .
SOURCE Human adenovirus 1
 ORGANISM Human adenovirus 1
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 684)
 AUTHORS Lauer,K.P., Llorente,I., Blair,E., Seto,J., Krasnov,V.,
 Purkayastha,A., Ditty,S.E., Hadfield,T.L., Buck,C., Tibbetts,C. and
 Seto,D.
 TITLE Natural variation among human adenoviruses: genome sequence and
 annotation of human adenovirus serotype 1
 JOURNAL J. Gen. Virol. 85 (Pt 9), 2615-2625 (2004)
 PUBMED 15302955
REFERENCE 2 (bases 1 to 684)
 AUTHORS Seto,D.
 TITLE Direct Submission
 JOURNAL Submitted (06-AUG-2002) Biomedical Genomics and Informatics, George
 Mason University, 10900 University Blvd, Manassas, VA 20110, USA
FEATURES Location/Qualifiers
 source 1..684
 /organism="Human adenovirus 1"
 /virion
  /mol_type="genomic DNA"
 /db_xref="taxon:10533"
 /note="subgroup: C"
 gene <1..>684
 /gene="L5"
 gene 1..684
 /gene="pVIII"
 CDS 1..684
 /gene="pVIII"
 /codon_start=1
 /product="hexon-associated protein 25 kDa"
 /protein_id="AAQ10558.1"
 /db_xref="GI:33330460"
 /translation="MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRINYMSAGPHMISRV
 NGIRAHRNRILLEQAAITTTPRNNLNPRSWPAALVYQESPAPTTVVLPRDAQAEVQMT
 NSGAQLAGGFRHRVRSPGQGITHLKIRGRGIQLNDESVSSSLGLRPDGTFQIGGAGRS
 SFTPRQAILTLQTSSSEPRSGGIGTLQFIEEFVPSVYFNPFSGPPGHYPDQFIPNFDA
 VKDSADGYD"
ORIGIN 
 1 atgagcaagg aaattcccac gccctacatg tggagttacc agccacaaat gggacttgcg
 61 gctggagctg cccaagacta ctcaacccga ataaactaca tgagcgcggg accccacatg
 121 atatcccggg tcaacggaat acgcgcccac cgaaaccgaa ttctcctgga acaggcggct
 181 attaccacca cacctcgtaa taaccttaat ccccgtagtt ggcccgctgc cctggtgtac
 241 caggaaagtc ccgctcccac cactgtggta cttcccagag acgcccaggc cgaagttcag
 301 atgactaact caggggcgca gcttgcgggc ggctttcgtc acagggtgcg gtcgcccggg
 361 cagggtataa ctcacctgaa aatcagaggg cgaggtattc agctcaacga cgagtcggtg
 421 agctcctcgc ttggtctccg tccggacggg acatttcaga tcggcggtgc cggccgctct
 481 tcatttacgc cccgtcaggc gatcttaact ctgcaaacct catcctcgga gccgcgctcc
 541 ggaggcattg gaactctaca atttattgag gagttcgtgc cttcggttta cttcaacccc
 601 ttttctggac ctcctggcca ctacccggac cagtttattc ccaactttga cgcggtgaag
 661 gactcggcgg acggctacga ctga
//