LOCUS ADRCG 1110 bp DNA linear VRL 14-MAR-1996
DEFINITION Adenovirus type 2, complete genome.
ACCESSION J01917 REGION: 16539..17648
VERSION J01917.1 GI:209811
KEYWORDS DNA polymerase; DNA-binding protein; RNA polymerase III;
alternative splicing; coat protein; complete genome; genome-linked
protein; glycoprotein; overlapping genes; polymerase; terminal
repeat; unidentified reading frame; virus-associated RNA.
SOURCE Human adenovirus 2
ORGANISM Human adenovirus 2
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
Human adenovirus C.
REFERENCE 1 (sites)
AUTHORS Ohe,K. and Weissman,S.M.
TITLE The nucleotide sequence of a low molecular weight ribonucleic acid
from cells infected with adenovirus 2
JOURNAL J. Biol. Chem. 246 (22), 6991-7009 (1971)
PUBMED 4331202
REFERENCE 2 (sites)
AUTHORS Jornvall,H., Ohlsson,H. and Philipson,L.
TITLE An acetylated N-terminus of adenovirus type 2 hexon protein
JOURNAL Biochem. Biophys. Res. Commun. 56 (2), 304-310 (1974)
PUBMED 4823869
REFERENCE 3 (sites)
AUTHORS Celma,M.L., Pan,J. and Weissman,S.M.
TITLE Studies of low molecular weight RNA from cells infected with
adenovirus 2. I. The sequences at the 3' end of VA-RNA I
JOURNAL J. Biol. Chem. 252 (24), 9032-9042 (1977)
PUBMED 318160
REFERENCE 4 (sites)
AUTHORS Celma,M.L., Pan,J. and Weissman,S.M.
TITLE Studies of low molecular weight RNA from cells infected with
adenovirus 2. II. Heterogeneity at the 5' end of VA-RNA I
JOURNAL J. Biol. Chem. 252 (24), 9043-9046 (1977)
PUBMED 925035
REFERENCE 5 (sites)
AUTHORS Akusjarvi,G. and Pettersson,U.
TITLE Nucleotide sequence at the junction between the coding region of
the adenovirus 2 hexon messenger RNA and its leader sequence
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 75 (12), 5822-5826 (1978)
PUBMED 83649
REFERENCE 6 (bases 1 to 1110)
AUTHORS Zain,S., Sambrook,J., Roberts,R.J., Keller,W., Fried,M. and
Dunn,A.R.
TITLE Nucleotide sequence analysis of the leader segments in a cloned
copy of adenovirus 2 fiber mRNA
JOURNAL Cell 16 (4), 851-861 (1979)
PUBMED 455453
REFERENCE 7 (sites)
AUTHORS Shinagawa,M. and Padmanabhan,R.
TITLE Nucleotide sequence at the inverted terminal repetition of
adenovirus type 2 DNA
JOURNAL Biochem. Biophys. Res. Commun. 87 (3), 671-678 (1979)
PUBMED 454416
REFERENCE 8 (sites)
AUTHORS Zain,B.S. and Roberts,R.J.
TITLE Sequences from the beginning of the fiber messenger RNA of
adenovirus-2
JOURNAL J. Mol. Biol. 131 (2), 341-352 (1979)
PUBMED 318165
REFERENCE 9 (sites)
AUTHORS Baker,C.C., Herisse,J., Courtois,G., Galibert,F. and Ziff,E.
TITLE Messenger RNA for the Ad2 DNA binding protein: DNA sequences
encoding the first leader and heterogenity at the mRNA 5' end
JOURNAL Cell 18 (2), 569-580 (1979)
PUBMED 227610
REFERENCE 10 (sites)
AUTHORS Perricaudet,M., Akusjarvi,G., Virtanen,A. and Pettersson,U.
TITLE Structure of two spliced mRNAs from the transforming region of
human subgroup C adenoviruses
JOURNAL Nature 281 (5733), 694-696 (1979)
PUBMED 551290
REFERENCE 11 (bases 1 to 1110)
AUTHORS Zain,S., Gingeras,T.R., Bullock,P., Wong,G. and Gelinas,R.E.
TITLE Determination and analysis of adenovirus-2 DNA sequences which may
include signals for late messenger RNA processing
JOURNAL J. Mol. Biol. 135 (2), 413-433 (1979)
PUBMED 318167
REFERENCE 12 (sites)
AUTHORS Baker,C.C. and Ziff,E.B.
TITLE Biogenesis, structures, and sites of encoding of the 5' termini of
adenovirus-2 mRNAs
JOURNAL Cold Spring Harb. Symp. Quant. Biol. 44 Pt 1,, 415-428 (1980)
PUBMED 6933038
REFERENCE 13 (sites)
AUTHORS Akusjarvi,G., Mathews,M.B., Andersson,P., Vennstrom,B. and
Pettersson,U.
TITLE Structure of genes for virus-associated RNAI and RNAII of
adenovirus type 2
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (5), 2424-2428 (1980)
PUBMED 6930642
REFERENCE 14 (sites)
AUTHORS Perricaudet,M., Le Moullec,J.M. and Pettersson,U.
TITLE Predicted structure of two adenovirus tumor antigens
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (7), 3778-3782 (1980)
PUBMED 6253988
REFERENCE 15 (sites)
AUTHORS Anderson,C.W. and Lewis,J.B.
TITLE Amino-terminal sequence of adenovirus type 2 proteins: hexon,
fiber, component IX, and early protein 1B-15K
JOURNAL Virology 104 (1), 27-41 (1980)
PUBMED 6985474
REFERENCE 16 (sites)
AUTHORS Persson,H., Jornvall,H. and Zabielski,J.
TITLE Multiple mRNA species for the precursor to an adenovirus-encoded
glycoprotein: identification and structure of the signal sequence
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (11), 6349-6353 (1980)
PUBMED 6985478
REFERENCE 17 (sites)
AUTHORS Van Etten,R.A., Walberg,M.W. and Clayton,D.A.
TITLE Precise localization and nucleotide sequence of the two mouse
mitochondrial rRNA genes and three immediately adjacent novel tRNA
genes
JOURNAL Cell 22 (1 Pt 1), 157-170 (1980)
PUBMED 7428037
REFERENCE 18 (sites)
AUTHORS Buttner,W. and Veres-Molnar,Z.
TITLE Localization of the 3'-terminal end of the EcoRI B
fragment-specific early mRNA of adenovirus type 2
JOURNAL FEBS Lett. 122 (2), 317-321 (1980)
PUBMED 6258984
REFERENCE 19 (sites)
AUTHORS Akusjarvi,G., Zabielski,J., Perricaudet,M. and Pettersson,U.
TITLE The sequence of the 3' non-coding region of the hexon mRNA
discloses a novel adenovirus gene
JOURNAL Nucleic Acids Res. 9 (1), 1-17 (1981)
PUBMED 6259616
REFERENCE 20 (sites)
AUTHORS Hashimoto,S., Pursley,M.H. and Green,M.
TITLE Nucleotide sequences and mapping of novel heterogenous 5'-termini
of adenovirus 2 early region 4 mRNA
JOURNAL Nucleic Acids Res. 9 (7), 1675-1689 (1981)
PUBMED 6164992
REFERENCE 21 (sites)
AUTHORS Akusjarvi,G. and Persson,H.
TITLE Gene and mRNA for precursor polypeptide VI from adenovirus type 2
JOURNAL J. Virol. 38 (2), 469-482 (1981)
PUBMED 6985479
REFERENCE 22 (sites)
AUTHORS Baker,C.C. and Ziff,E.B.
TITLE Promoters and heterogeneous 5' termini of the messenger RNAs of
adenovirus serotype 2
JOURNAL J. Mol. Biol. 149 (2), 189-221 (1981)
PUBMED 6927849
REFERENCE 23 (sites)
AUTHORS Akusjarvi,G. and Persson,H.
TITLE Controls of RNA splicing and termination in the major late
adenovirus transcription unit
JOURNAL Nature 292 (5822), 420-426 (1981)
PUBMED 7254339
REFERENCE 24 (sites)
AUTHORS Kruijer,W., van Schaik,F.M. and Sussenbach,J.S.
TITLE Structure and organization of the gene coding for the DNA binding
protein of adenovirus type 5
JOURNAL Nucleic Acids Res. 9 (18), 4439-4457 (1981)
PUBMED 6117824
REFERENCE 25 (sites)
AUTHORS van Beveren,C.P., Maat,J., Dekker,B.M. and van Ormondt,H.
TITLE The nucleotide sequence of the gene for protein IVa2 and of the 5'
leader segment of the major late mRNAs of adenovirus type 5
JOURNAL Gene 16 (1-3), 179-189 (1981)
PUBMED 7343420
REFERENCE 26 (sites)
AUTHORS Uhlen,M., Svensson,C., Josephson,S., Alestrom,P.,
Chattapadhyaya,J.B., Pettersson,U. and Philipson,L.
TITLE Leader arrangement in the adenovirus fiber mRNA
JOURNAL EMBO J. 1 (2), 249-254 (1982)
PUBMED 6897915
REFERENCE 27 (sites)
AUTHORS Osborne,T.F., Gaynor,R.B. and Berk,A.J.
TITLE The TATA homology and the mRNA 5' untranslated sequence are not
required for expression of essential adenovirus E1A functions
JOURNAL Cell 29 (1), 139-148 (1982)
PUBMED 7105179
REFERENCE 28 (sites)
AUTHORS Gingeras,T.R., Sciaky,D., Gelinas,R.E., Bing-Dong,J., Yen,C.E.,
Kelly,M.M., Bullock,P.A., Parsons,B.L., O'Neill,K.E. and
Roberts,R.J.
TITLE Nucleotide sequences from the adenovirus-2 genome
JOURNAL J. Biol. Chem. 257 (22), 13475-13491 (1982)
PUBMED 7142161
REFERENCE 29 (sites)
AUTHORS Alestrom,P., Akusjarvi,G., Pettersson,M. and Pettersson,U.
TITLE DNA sequence analysis of the region encoding the terminal protein
and the hypothetical N-gene product of adenovirus type 2
JOURNAL J. Biol. Chem. 257 (22), 13492-13498 (1982)
PUBMED 7142162
REFERENCE 30 (sites)
AUTHORS Ahmed,C.M., Chanda,R.S., Stow,N.D. and Zain,B.S.
TITLE The nucleotide sequence of mRNA for the Mr 19 000 glycoprotein from
early gene block III of adenovirus 2
JOURNAL Gene 20 (3), 339-346 (1982)
PUBMED 6985487
REFERENCE 31 (sites)
AUTHORS Oosterom-Dragon,E.A. and Anderson,C.W.
TITLE Polypeptide structure and encoding location of the adenovirus
serotype 2 late, nonstructural 33K protein
JOURNAL J. Virol. 45 (1), 251-263 (1983)
PUBMED 6296434
REFERENCE 32 (sites)
AUTHORS Downey,J.F., Rowe,D.T., Bacchetti,S., Graham,F.L. and Bayley,S.T.
TITLE Mapping of a 14,000-dalton antigen to early region 4 of the human
adenovirus 5 genome
JOURNAL J. Virol. 45 (2), 514-523 (1983)
PUBMED 6834467
REFERENCE 33 (sites)
AUTHORS Goldenberg,C.J. and Hauser,S.D.
TITLE Accurate and efficient in vitro splicing of purified precursor RNAs
specified by early region 2 of the adenovirus 2 genome
JOURNAL Nucleic Acids Res. 11 (5), 1337-1348 (1983)
PUBMED 6186991
REFERENCE 34 (sites)
AUTHORS Virtanen,A. and Pettersson,U.
TITLE The molecular structure of the 9S mRNA from early region 1A of
adenovirus serotype 2
JOURNAL J. Mol. Biol. 165 (3), 496-499 (1983)
PUBMED 6842608
REFERENCE 35 (sites)
AUTHORS Stalhandske,P., Persson,H., Perricaudet,M., Philipson,L. and
Pettersson,U.
TITLE Structure of three spliced mRNAs from region E3 of adenovirus type
2
JOURNAL Gene 22 (2-3), 157-165 (1983)
PUBMED 6307816
REFERENCE 36 (sites)
AUTHORS Sung,M.T., Cao,T.M., Coleman,R.T. and Budelier,K.A.
TITLE Gene and protein sequences of adenovirus protein VII, a hybrid
basic chromosomal protein
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (10), 2902-2906 (1983)
PUBMED 6574459
REFERENCE 37 (sites)
AUTHORS Lewis,J.B. and Anderson,C.W.
TITLE Proteins encoded near the adenovirus late messenger RNA leader
segments
JOURNAL Virology 127 (1), 112-123 (1983)
PUBMED 6857999
REFERENCE 38 (sites)
AUTHORS Yeh-Kai,L., Akusjarvi,G., Alestrom,P., Pettersson,U., Tremblay,M.
and Weber,J.
TITLE Genetic identification of an endoproteinase encoded by the
adenovirus genome
JOURNAL J. Mol. Biol. 167 (1), 217-222 (1983)
PUBMED 6306252
REFERENCE 39 (bases 1001 to 1110)
AUTHORS Sung,M.T., Cao,T.M., Lischwe,M.A. and Coleman,R.T.
TITLE Molecular processing of adenovirus proteins
JOURNAL J. Biol. Chem. 258 (13), 8266-8272 (1983)
PUBMED 6336325
REFERENCE 40 (sites)
AUTHORS Kruijer,W., van Schaik,F.M., Speijer,J.G. and Sussenbach,J.S.
TITLE Structure and function of adenovirus DNA binding protein:
comparison of the amino acid sequences of the Ad5 and Ad12 proteins
derived from the nucleotide sequence of the corresponding genes
JOURNAL Virology 128 (1), 140-153 (1983)
PUBMED 6308889
REFERENCE 41 (sites)
AUTHORS Le Moullec,J.M., Akusjarvi,G., Stalhandske,P., Pettersson,U.,
Chambraud,B., Gilardi,P., Nasri,M. and Perricaudet,M.
TITLE Polyadenylic acid addition sites in the adenovirus type 2 major
late transcription unit
JOURNAL J. Virol. 48 (1), 127-134 (1983)
PUBMED 6136617
REFERENCE 42 (sites)
AUTHORS Tigges,M.A. and Raskas,H.J.
TITLE Splice junctions in adenovirus 2 early region 4 mRNAs: multiple
splice sites produce 18 to 24 RNAs
JOURNAL J. Virol. 50 (1), 106-117 (1984)
PUBMED 6336328
REFERENCE 43 (sites)
AUTHORS Downey,J.F., Evelegh,C.M., Branton,P.E. and Bayley,S.T.
TITLE Peptide maps and N-terminal sequences of polypeptides from early
region 1A of human adenovirus 5
JOURNAL J. Virol. 50 (1), 30-37 (1984)
PUBMED 6699947
REFERENCE 44 (sites)
AUTHORS Freyer,G.A., Katoh,Y. and Roberts,R.J.
TITLE Characterization of the major mRNAs from adenovirus 2 early region
4 by cDNA cloning and sequencing
JOURNAL Nucleic Acids Res. 12 (8), 3503-3519 (1984)
PUBMED 6145146
REFERENCE 45 (sites)
AUTHORS Leff,T., Elkaim,R., Goding,C.R., Jalinot,P., Sassone-Corsi,P.,
Perricaudet,M., Kedinger,C. and Chambon,P.
TITLE Individual products of the adenovirus 12S and 13S EIa mRNAs
stimulate viral EIIa and EIII expression at the transcriptional
level
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (14), 4381-4385 (1984)
PUBMED 6336330
REFERENCE 46 (sites)
AUTHORS Padgett,R.A., Konarska,M.M., Grabowski,P.J., Hardy,S.F. and
Sharp,P.A.
TITLE Lariat RNA's as intermediates and products in the splicing of
messenger RNA precursors
JOURNAL Science 225 (4665), 898-903 (1984)
PUBMED 6206566
REFERENCE 47 (sites)
AUTHORS Natarajan,V., Madden,M.J. and Salzman,N.P.
TITLE Proximal and distal domains that control in vitro transcription of
the adenovirus IVa2 gene
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (20), 6290-6294 (1984)
PUBMED 6593702
REFERENCE 48 (sites)
AUTHORS Wold,W.S., Cladaras,C., Magie,S.C. and Yacoub,N.
TITLE Mapping a new gene that encodes an 11,600-molecular-weight protein
in the E3 transcription unit of adenovirus 2
JOURNAL J. Virol. 52 (2), 307-313 (1984)
PUBMED 6492252
REFERENCE 49 (sites)
AUTHORS Mautner,V. and Mackay,N.
TITLE Recombination in adenovirus: analysis of crossover sites in
intertypic overlap recombinants
JOURNAL Virology 139 (1), 43-52 (1984)
PUBMED 6495658
REFERENCE 50 (bases 1 to 1110)
AUTHORS Alestrom,P., Akusjarvi,G., Lager,M., Yeh-kai,L. and Pettersson,U.
TITLE Genes encoding the core proteins of adenovirus type 2
JOURNAL J. Biol. Chem. 259 (22), 13980-13985 (1984)
PUBMED 6094534
REFERENCE 51 (sites)
AUTHORS Roberts,R.J., O'Neill,K.E. and Yen,C.T.
TITLE DNA sequences from the adenovirus 2 genome
JOURNAL J. Biol. Chem. 259 (22), 13968-13975 (1984)
PUBMED 6334081
REFERENCE 52 (sites)
AUTHORS Moore,C.L. and Sharp,P.A.
TITLE Accurate cleavage and polyadenylation of exogenous RNA substrate
JOURNAL Cell 41 (3), 845-855 (1985)
PUBMED 2408761
REFERENCE 53 (sites)
AUTHORS Roberts,R.J., Akusjaervi,G., Alestroem,P., Gelinas,R.E.,
Gingeras,T.R., Sciaky,D. and Pettersson,U.
TITLE A consensus sequence for the adenovirus-2 genome
JOURNAL (in) Doerfler,W. (Ed.);
ADENOVIRUS DNA: 1-51;
Martinus Nijhoff Publishing, Boston (1986)
REFERENCE 54 (sites)
AUTHORS Anderson,C.W., Schmitt,R.C., Smart,J.E. and Lewis,J.B.
TITLE Early region 1B of adenovirus serotype 2 encodes two co-terminal
proteins of 495 and 155 amino acid residues
JOURNAL Unpublished (1984)
REFERENCE 55 (sites)
AUTHORS Virtanen,A. and Pettersson,U.
JOURNAL Unpublished (1984)
COMMENT [1] RNA.
[2] sites; cds start for the hexon protein.
[4] sites; 5' terminus of VA I RNA.
[6] mRNA and DNA.
[11] cDNA to hexon mRNA.
[12] several fragments over this span;.
[13] mRNA and DNA.
[19] cDNA.
[16] sites; acceptor splice site for fiber mRNA.
[18] several leader fragments over this span.
[27] sites; splice sites for E1b mRNAs.
[28] sites; cds start for E3 19K glycoprotein.
[29] sites; cds start for 15K, IX and fiber polypeptides. [37]
sites; cap site for E4 mrnas.
[39] sites; splice sites in E2a mRNA.
[31] fragments over this span.
[34] sites; splice site in 52,55K-pept mRNA.
[30] sites; splice sites in IVa2 mRNA, Ad5.
[43] cDNA and DNA.
[42] sites; splice site for 'i' leader.
[46] mRNA and DNA.
[41] sites; E1a mutational analysis.
[55] sites; splice sites for 33K mRNA.
[56] sites; cds start for E4 11K-pept, ad5.
[60] sites; cds start for the 13.6K-pept.
[61] sites; splice sites for 72K and 100K mRNAs.
[50] sites; splice sites for leaders; poly-A sites. [52] sites;
splice sites for E1a mRNAs.
[58] sites; splice sites in E2 mRNA.
[53] sites; H2ts1 mutation between 57.0% and 69.0%. [49] H2ts125
strain.
[68] sites; cds start for E1a proteins.
[69] sites; splice sites in E4 region.
[71] sites; splice sites in E4 region; poly-A site for E4 mRNAs.
[63] sites; cds start for 57K-pept.
[63] sites; splice sites in E4 region; poly-A site for E4 mRNAs.
[63] sites; splice sites in E1b region.
[(in) Doerfler,W. (Ed.);Adenovirus DNA: 1-51;Martinus Nijhoff
Publishing, Boston ] review; bases 1 to 35937.
[75] sites; recombination analysis of ad2 and ad5. [74] sites;
splice sites in major late mRNA.
[73] sites; IVa2 transcription start.
[72] sites; transcription start for EIa mRNAs.
[70] sites; E3 11.6 -K protein.
[76] sites; L3 mRNA polyadenylation site.
[78] sites; L3 mRNA polyadenylation site.
Communicated on tape by R. Roberts. That tape and [(in) Doerfler,
W. (Ed.);Adenovirus DNA: 1-51;Martinus Nijhoff Publishing, Boston ]
are the
immediate sources of the annotation herein.
A consensus sequence for the l-strand of the genome is shown.
Population heterogeneity as distinct from strain variation is known
(35937 +/- 9 bp) [67]; both are annotated as 'variation' below. For
site differences with adenovirus type 5, see loci beginning <ad5>
which are arranged in the library according to the map coordinates
of <ad2> where one map unit corresponds to 360 bases throughout
(see [44],[67]). For mutational changes in the ad2 sequence, see
the appropriate references above.
The origin of replication is located in the first fifty bases from
each end.
Transcription is leftward off the l-strand and rightward off the
r-strand; in the former case, the annotation shows '(c)' for
complementary strand. Complex splicing events give rise to perhaps
fifty or more distinct mRNA transcripts at early, intermediate and
late times after infection, many of which are still being
characterized; in particular, some transcripts are known from
electron microscopy which are not yet characterized at the sequence
level. To date nine mRNA start sites (cap sites) have been
identified, and these define the general units of mRNAs under which
all known transcripts are classified.
From the r-strand, the early transcripts are E1a, E1b and E3. The
28 kb late transcript called herein 'major late mRNA' comprises
five families, L1 through L5, of 3' co-terminal mRNAs. L1, and to
a lesser extent L2, can be expressed at early and intermediate
times [34]. Transcripts from this region contain a common
tripartite leader sequence at their 5' ends: the three segments of
this leader are encoded at bases 6039-6079, 7101-7172 and
9634-9723. At early and intermediate times, an extra leader
segment, the 'i' leader, is frequently present (bases 7942-8381).
The IX message, the only unspliced message in ad2, is intermediate,
and its termination overlaps that for E1b on the same strand and
that for IVa2, and most likely E2b, on the opposite strand. From
the l-strand, or the 'comp strand', early expression derives from
the E2a, E2b and E4 families of mRNAs, although there can be late
transcription from E2a. The E2b cap sites, splice sites and
termination sites have not been determined at the sequence level.
From electron microscopy there is evidence that the E2b mRNAs may
originate at the E2a early cap site at 27092 (c) and terminate at
the poly-A addition site found for the IVa2 mRNA at 4050 (c) [44].
IVa2 is an intermediate message. The promoters for these nine
classes of mRNAs can be localized and characterized to the
following extent [32]:
mRNA cap site possible promoter region
------ ---------- -----------------------------
E1a 498 tatttata at 468-474
E1b 1699 tatataat at 1669-1676
IX 3576 tatataa at 3545-3551
major late 6039 tataaaa at 6008-6014
E3 27609 tataa at 27580-27584
E4 35609 (c) tatatata at 35641-35633 (c)
E2a early 27092 (c) no obvious sequence for 100 bases
upstream
E2a late 25956 (c) tacaaattt at 25985-25977 (c)
IVa2 5826 (c) no obvious sequence for 100 bases
upstream
The mRNA responsible for the 13.6K protein encoded at 7968 has not
been identified. The VA I and VA II transcripts are unique in that
they are generated by RNA polymerase III; for a discussion of these
low molecular weight RNAs-- the modulation of their start points,
their promoters, their heterogeneity and their similarity to tRNA--
see [3],[4],[5],[26] and <ad5a2>.
The proteins known to be encoded from these mRNAs are given in the
Features table below, though the details of translation and
processing have not been fully determined. In cases such as the
IIIa peptide or the 11K peptide, the exact span of the coding
awaits elucidation of the mRNA splicing. Some of these products
share reading frames and therefore manifest partial homologies. The
following table summarizes the unidentified reading frames ('URF')
of 100 or more amino acids:
initiator terminator frame protein encoded
----------- ---------- ------- -----------------
6280 6600 1 11.6K URF
17284 17763 1 17.4K URF
23782 24138 1 12.9K URF
24481 24867 1 14.2K URF
26044 26826 1 28.6K URF(contains the
N-terminus of 33K cds)
30973 32778 1 63.9K URF(contains the
fiber cds)
10421 10834 2 14.4K URF
20504 20935 2 15.7K URF
27899 28222 2 12.4K URF
30059 30451 2 14.5k URF
33956 34456 2 18.8K URF
9294 9800 3 17.7K URF
23526 26525 3 110.2K URF(contains the
100K-pept cds)
30444 30830 3 14.7K URF
34470 34808 3 12.7K URF
complementary strand
---------------------------
35532 35146 1 14.3K URF
34077 33193 1 34.1K URF
11109 10744 1 12.8K URF
9030 8383 1 22.8K URF
6780 6442 1 12.8K URF
31604 31290 2 10.7K URF
31211 30852 2 13.5K URF
18707 18159 2 18.9K URF
14861 14424 2 16.4K URF
14114 13728 2 13.5K URF
11618 11250 2 13.6K URF
1712 1194 2 18.1K URF
35113 34703 3 15.3K URF
34342 33998 3 13.3K URF
5674 5327 3 12.2K URF Additionally
there are numerous unidentified reading frames of less than 100
amino acid residues; and further small modifications of a few of
the coding sequences are possible.
[7] missing data project.
FEATURES Location/Qualifiers
source 1..1110
/organism="Human adenovirus 2"
/mol_type="genomic DNA"
/db_xref="taxon:10515"
gene complement(<1..>1110)
/gene="E2b"
mRNA complement(<1..>1110)
/gene="E2b"
/citation=[28]
prim_transcript <1..>1110
/citation=[22]
gene <1..>1110
/gene="L5"
prim_transcript <1..>1110
/gene="L4"
/citation=[22]
gene <1..>1110
/gene="L4"
prim_transcript <1..>1110
/gene="L4"
/citation=[19]
gene <1..>1110
/gene="L3_1"
prim_transcript <1..>1110
/gene="L3_1"
/citation=[21]
intron <1..>1110
/gene="L4"
/note="precedes 100K mRNA"
/citation=[40]
intron <1..>1110
/gene="L4"
/note="precedes 23K mRNA"
/citation=[19]
intron <1..>1110
/gene="L3_1"
/note="precedes hexon mRNA"
/citation=[5]
intron <1..>1110
/gene="L3_1"
/note="precedes pVI mRNA"
/citation=[21]
gene 1..1110
/gene="pV"
CDS 1..1110
/gene="pV"
/codon_start=1
/product="minor core protein"
/protein_id="AAA92213.1"
/db_xref="GI:209829"
/translation="MSKRKIKEEMLQVIAPEIYGPPKKEEQDYKPRKLKRVKKKKKDD
DDDELDDEVELLHATAPRRRVQWKGRRVRRVLRPGTTVVFTPGERSTRTYKRVYDEVY
GDEDLLEQANERLGEFAYGKRHKDMLALPLDEGNPTPSLKPVTLQQVLPTLAPSEEKR
GLKRESGDLAPTVQLMVPKRQRLEDVLEKMTVEPGLEPEVRVRPIKQVAPGLGVQTVD
VQIPTTSSTSIATATEGMETQTSPVASAVADAAVQAAAAAASKTSTEVQTDPWMFRVS
APRRPRRSRKYGTASALLPEYALHPSIAPTPGYRGYTYRPRRRATTRRRTTTGTRRRR
RRRQPVLAPISVRRVAREGGRTLVLPTARYHPSIV"
ORIGIN
1 atgtccaagc gcaaaatcaa agaagagatg ctccaggtca tcgcgccgga gatctatggc
61 cccccgaaga aggaagagca ggattacaag ccccgaaagc taaagcgggt caaaaagaaa
121 aagaaagatg atgatgatga tgaacttgac gacgaggtgg aactgctgca cgcaaccgcg
181 cccaggcggc gggtacagtg gaaaggtcga cgcgtaagac gtgttttgcg acccggcacc
241 accgtagttt ttacgcccgg tgagcgctcc acccgcacct acaagcgcgt gtatgatgag
301 gtgtacggcg acgaggacct gcttgagcag gccaacgagc gcctcgggga gtttgcctac
361 ggaaagcggc ataaggacat gttggcgttg ccgctggacg agggcaaccc aacacctagc
421 ctaaagcccg tgacactgca gcaggtgctg cccacgcttg caccgtccga agaaaagcgc
481 ggcctaaagc gcgagtctgg tgacttggca cccaccgtgc agctgatggt acccaagcgc
541 cagcgactgg aagatgtctt ggaaaaaatg accgtggagc ctgggctgga gcccgaggtc
601 cgcgtgcggc caatcaagca ggtggcaccg ggactgggcg tgcagaccgt ggacgttcag
661 atacccacca ccagtagcac tagtattgcc actgccacag agggcatgga gacacaaacg
721 tccccggttg cctcggcggt ggcagatgcc gcggtgcagg cggccgctgc ggccgcgtcc
781 aaaacctcta cggaggtgca aacggacccg tggatgtttc gcgtttcagc cccccggcgc
841 ccgcgccgtt ccaggaagta cggcaccgcc agcgcactac tgcccgaata tgccctacat
901 ccttccatcg cgcctacccc cggctatcgt ggctacacct accgccccag aagacgagcg
961 actacccgac gccgaaccac cactggaacc cgccgccgcc gtcgccgtcg ccagcccgtg
1021 ctggccccga tttccgtgcg cagggtggct cgcgaaggag gcaggaccct ggtgctgcca
1081 acagcgcgct accaccccag catcgtttaa
//