LOCUS ADRCG 3171 bp DNA linear VRL 14-MAR-1996
DEFINITION Adenovirus type 2, complete genome.
ACCESSION J01917 REGION: 5187..8357
VERSION J01917.1 GI:209811
KEYWORDS DNA polymerase; DNA-binding protein; RNA polymerase III;
 alternative splicing; coat protein; complete genome; genome-linked
 protein; glycoprotein; overlapping genes; polymerase; terminal
 repeat; unidentified reading frame; virus-associated RNA.
SOURCE Human adenovirus 2
 ORGANISM Human adenovirus 2
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (sites)
 AUTHORS Ohe,K. and Weissman,S.M.
 TITLE The nucleotide sequence of a low molecular weight ribonucleic acid
  from cells infected with adenovirus 2
 JOURNAL J. Biol. Chem. 246 (22), 6991-7009 (1971)
 PUBMED 4331202
REFERENCE 2 (sites)
 AUTHORS Jornvall,H., Ohlsson,H. and Philipson,L.
 TITLE An acetylated N-terminus of adenovirus type 2 hexon protein
 JOURNAL Biochem. Biophys. Res. Commun. 56 (2), 304-310 (1974)
 PUBMED 4823869
REFERENCE 3 (sites)
 AUTHORS Celma,M.L., Pan,J. and Weissman,S.M.
 TITLE Studies of low molecular weight RNA from cells infected with
 adenovirus 2. I. The sequences at the 3' end of VA-RNA I
 JOURNAL J. Biol. Chem. 252 (24), 9032-9042 (1977)
 PUBMED 318160
REFERENCE 4 (sites)
 AUTHORS Celma,M.L., Pan,J. and Weissman,S.M.
 TITLE Studies of low molecular weight RNA from cells infected with
 adenovirus 2. II. Heterogeneity at the 5' end of VA-RNA I
 JOURNAL J. Biol. Chem. 252 (24), 9043-9046 (1977)
 PUBMED 925035
REFERENCE 5 (sites)
 AUTHORS Akusjarvi,G. and Pettersson,U.
 TITLE Nucleotide sequence at the junction between the coding region of
 the adenovirus 2 hexon messenger RNA and its leader sequence
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 75 (12), 5822-5826 (1978)
 PUBMED 83649
REFERENCE 6 (bases 800 to 1050)
 AUTHORS Ziff,E.B. and Evans,R.M.
 TITLE Coincidence of the promoter and capped 5' terminus of RNA from the
 adenovirus 2 major late transcription unit
 JOURNAL Cell 15 (4), 1463-1475 (1978)
 PUBMED 729003
REFERENCE 7 (bases 853 to 893; 1915 to 1986)
 AUTHORS Akusjarvi,G. and Pettersson,U.
 TITLE Sequence analysis of adenovirus DNA: complete nucleotide sequence
 of the spliced 5' noncoding region of adenovirus 2 hexon messenger
 RNA
 JOURNAL Cell 16 (4), 841-850 (1979)
 PUBMED 455452
REFERENCE 8 (bases 853 to 3171)
 AUTHORS Zain,S., Sambrook,J., Roberts,R.J., Keller,W., Fried,M. and
 Dunn,A.R.
 TITLE Nucleotide sequence analysis of the leader segments in a cloned
 copy of adenovirus 2 fiber mRNA
 JOURNAL Cell 16 (4), 851-861 (1979)
 PUBMED 455453
REFERENCE 9 (sites)
 AUTHORS Shinagawa,M. and Padmanabhan,R.
 TITLE Nucleotide sequence at the inverted terminal repetition of
 adenovirus type 2 DNA
 JOURNAL Biochem. Biophys. Res. Commun. 87 (3), 671-678 (1979)
 PUBMED 454416
REFERENCE 10 (sites)
 AUTHORS Zain,B.S. and Roberts,R.J.
 TITLE Sequences from the beginning of the fiber messenger RNA of
 adenovirus-2
 JOURNAL J. Mol. Biol. 131 (2), 341-352 (1979)
 PUBMED 318165
REFERENCE 11 (sites)
 AUTHORS Baker,C.C., Herisse,J., Courtois,G., Galibert,F. and Ziff,E.
 TITLE Messenger RNA for the Ad2 DNA binding protein: DNA sequences
 encoding the first leader and heterogenity at the mRNA 5' end
 JOURNAL Cell 18 (2), 569-580 (1979)
 PUBMED 227610
REFERENCE 12 (bases 723 to 992; 1837 to 2026)
 AUTHORS Akusjarvi,G. and Pettersson,J.
 TITLE Sequence analysis of adenovirus DNA. IV. The genomic sequences
 encoding the common tripartite leader of late adenovirus messenger
 RNA
 JOURNAL J. Mol. Biol. 134 (1), 143-158 (1979)
 PUBMED 318166
REFERENCE 13 (sites)
 AUTHORS Perricaudet,M., Akusjarvi,G., Virtanen,A. and Pettersson,U.
 TITLE Structure of two spliced mRNAs from the transforming region of
 human subgroup C adenoviruses
 JOURNAL Nature 281 (5733), 694-696 (1979)
 PUBMED 551290
REFERENCE 14 (bases 853 to 3171)
 AUTHORS Zain,S., Gingeras,T.R., Bullock,P., Wong,G. and Gelinas,R.E.
 TITLE Determination and analysis of adenovirus-2 DNA sequences which may
 include signals for late messenger RNA processing
 JOURNAL J. Mol. Biol. 135 (2), 413-433 (1979)
 PUBMED 318167
REFERENCE 15 (bases 662 to 1392)
 AUTHORS Baker,C.C. and Ziff,E.B.
 TITLE Biogenesis, structures, and sites of encoding of the 5' termini of
 adenovirus-2 mRNAs
 JOURNAL Cold Spring Harb. Symp. Quant. Biol. 44 Pt 1,, 415-428 (1980)
 PUBMED 6933038
REFERENCE 16 (sites)
 AUTHORS Akusjarvi,G., Mathews,M.B., Andersson,P., Vennstrom,B. and
 Pettersson,U.
 TITLE Structure of genes for virus-associated RNAI and RNAII of
 adenovirus type 2
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (5), 2424-2428 (1980)
 PUBMED 6930642
REFERENCE 17 (sites)
 AUTHORS Perricaudet,M., Le Moullec,J.M. and Pettersson,U.
 TITLE Predicted structure of two adenovirus tumor antigens
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (7), 3778-3782 (1980)
 PUBMED 6253988
REFERENCE 18 (sites)
 AUTHORS Anderson,C.W. and Lewis,J.B.
 TITLE Amino-terminal sequence of adenovirus type 2 proteins: hexon,
 fiber, component IX, and early protein 1B-15K
 JOURNAL Virology 104 (1), 27-41 (1980)
 PUBMED 6985474
REFERENCE 19 (sites)
 AUTHORS Persson,H., Jornvall,H. and Zabielski,J.
  TITLE Multiple mRNA species for the precursor to an adenovirus-encoded
 glycoprotein: identification and structure of the signal sequence
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (11), 6349-6353 (1980)
 PUBMED 6985478
REFERENCE 20 (sites)
 AUTHORS Van Etten,R.A., Walberg,M.W. and Clayton,D.A.
 TITLE Precise localization and nucleotide sequence of the two mouse
 mitochondrial rRNA genes and three immediately adjacent novel tRNA
 genes
 JOURNAL Cell 22 (1 Pt 1), 157-170 (1980)
 PUBMED 7428037
REFERENCE 21 (sites)
 AUTHORS Buttner,W. and Veres-Molnar,Z.
 TITLE Localization of the 3'-terminal end of the EcoRI B
 fragment-specific early mRNA of adenovirus type 2
 JOURNAL FEBS Lett. 122 (2), 317-321 (1980)
 PUBMED 6258984
REFERENCE 22 (sites)
 AUTHORS Akusjarvi,G., Zabielski,J., Perricaudet,M. and Pettersson,U.
 TITLE The sequence of the 3' non-coding region of the hexon mRNA
 discloses a novel adenovirus gene
 JOURNAL Nucleic Acids Res. 9 (1), 1-17 (1981)
 PUBMED 6259616
REFERENCE 23 (sites)
 AUTHORS Hashimoto,S., Pursley,M.H. and Green,M.
 TITLE Nucleotide sequences and mapping of novel heterogenous 5'-termini
 of adenovirus 2 early region 4 mRNA
 JOURNAL Nucleic Acids Res. 9 (7), 1675-1689 (1981)
 PUBMED 6164992
REFERENCE 24 (sites)
 AUTHORS Akusjarvi,G. and Persson,H.
 TITLE Gene and mRNA for precursor polypeptide VI from adenovirus type 2
 JOURNAL J. Virol. 38 (2), 469-482 (1981)
 PUBMED 6985479
REFERENCE 25 (bases 631 to 865)
 AUTHORS Baker,C.C. and Ziff,E.B.
 TITLE Promoters and heterogeneous 5' termini of the messenger RNAs of
 adenovirus serotype 2
 JOURNAL J. Mol. Biol. 149 (2), 189-221 (1981)
 PUBMED 6927849
REFERENCE 26 (sites)
 AUTHORS Akusjarvi,G. and Persson,H.
 TITLE Controls of RNA splicing and termination in the major late
 adenovirus transcription unit
 JOURNAL Nature 292 (5822), 420-426 (1981)
 PUBMED 7254339
REFERENCE 27 (sites)
 AUTHORS Kruijer,W., van Schaik,F.M. and Sussenbach,J.S.
 TITLE Structure and organization of the gene coding for the DNA binding
  protein of adenovirus type 5
 JOURNAL Nucleic Acids Res. 9 (18), 4439-4457 (1981)
 PUBMED 6117824
REFERENCE 28 (sites)
 AUTHORS van Beveren,C.P., Maat,J., Dekker,B.M. and van Ormondt,H.
 TITLE The nucleotide sequence of the gene for protein IVa2 and of the 5'
 leader segment of the major late mRNAs of adenovirus type 5
 JOURNAL Gene 16 (1-3), 179-189 (1981)
 PUBMED 7343420
REFERENCE 29 (sites)
 AUTHORS Uhlen,M., Svensson,C., Josephson,S., Alestrom,P.,
 Chattapadhyaya,J.B., Pettersson,U. and Philipson,L.
  TITLE Leader arrangement in the adenovirus fiber mRNA
 JOURNAL EMBO J. 1 (2), 249-254 (1982)
 PUBMED 6897915
REFERENCE 30 (bases 2683 to 3171)
  AUTHORS Virtanen,A., Alestrom,P., Persson,H., Katze,M.G. and Pettersson,U.
 TITLE An adenovirus agnogene
 JOURNAL Nucleic Acids Res. 10 (8), 2539-2548 (1982)
 PUBMED 6281734
REFERENCE 31 (sites)
 AUTHORS Osborne,T.F., Gaynor,R.B. and Berk,A.J.
 TITLE The TATA homology and the mRNA 5' untranslated sequence are not
 required for expression of essential adenovirus E1A functions
 JOURNAL Cell 29 (1), 139-148 (1982)
 PUBMED 7105179
REFERENCE 32 (bases 1 to 3171)
 AUTHORS Gingeras,T.R., Sciaky,D., Gelinas,R.E., Bing-Dong,J., Yen,C.E.,
 Kelly,M.M., Bullock,P.A., Parsons,B.L., O'Neill,K.E. and
 Roberts,R.J.
 TITLE Nucleotide sequences from the adenovirus-2 genome
 JOURNAL J. Biol. Chem. 257 (22), 13475-13491 (1982)
 PUBMED 7142161
REFERENCE 33 (bases 592 to 3171)
 AUTHORS Alestrom,P., Akusjarvi,G., Pettersson,M. and Pettersson,U.
 TITLE DNA sequence analysis of the region encoding the terminal protein
 and the hypothetical N-gene product of adenovirus type 2
 JOURNAL J. Biol. Chem. 257 (22), 13492-13498 (1982)
 PUBMED 7142162
REFERENCE 34 (sites)
 AUTHORS Ahmed,C.M., Chanda,R.S., Stow,N.D. and Zain,B.S.
 TITLE The nucleotide sequence of mRNA for the Mr 19 000 glycoprotein from
 early gene block III of adenovirus 2
 JOURNAL Gene 20 (3), 339-346 (1982)
 PUBMED 6985487
REFERENCE 35 (sites)
 AUTHORS Oosterom-Dragon,E.A. and Anderson,C.W.
 TITLE Polypeptide structure and encoding location of the adenovirus
 serotype 2 late, nonstructural 33K protein
 JOURNAL J. Virol. 45 (1), 251-263 (1983)
 PUBMED 6296434
REFERENCE 36 (bases 2743 to 3171)
 AUTHORS Falvey,E. and Ziff,E.
 TITLE Sequence arrangement and protein coding capacity of the adenovirus
 type 2 'i' leader
 JOURNAL J. Virol. 45 (1), 185-191 (1983)
 PUBMED 6823011
REFERENCE 37 (sites)
 AUTHORS Downey,J.F., Rowe,D.T., Bacchetti,S., Graham,F.L. and Bayley,S.T.
 TITLE Mapping of a 14,000-dalton antigen to early region 4 of the human
 adenovirus 5 genome
 JOURNAL J. Virol. 45 (2), 514-523 (1983)
 PUBMED 6834467
REFERENCE 38 (sites)
 AUTHORS Goldenberg,C.J. and Hauser,S.D.
 TITLE Accurate and efficient in vitro splicing of purified precursor RNAs
 specified by early region 2 of the adenovirus 2 genome
 JOURNAL Nucleic Acids Res. 11 (5), 1337-1348 (1983)
 PUBMED 6186991
REFERENCE 39 (sites)
 AUTHORS Virtanen,A. and Pettersson,U.
 TITLE The molecular structure of the 9S mRNA from early region 1A of
 adenovirus serotype 2
 JOURNAL J. Mol. Biol. 165 (3), 496-499 (1983)
 PUBMED 6842608
REFERENCE 40 (sites)
 AUTHORS Stalhandske,P., Persson,H., Perricaudet,M., Philipson,L. and
 Pettersson,U.
 TITLE Structure of three spliced mRNAs from region E3 of adenovirus type
 2
 JOURNAL Gene 22 (2-3), 157-165 (1983)
 PUBMED 6307816
REFERENCE 41 (sites)
 AUTHORS Sung,M.T., Cao,T.M., Coleman,R.T. and Budelier,K.A.
 TITLE Gene and protein sequences of adenovirus protein VII, a hybrid
  basic chromosomal protein
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (10), 2902-2906 (1983)
 PUBMED 6574459
REFERENCE 42 (sites)
 AUTHORS Lewis,J.B. and Anderson,C.W.
 TITLE Proteins encoded near the adenovirus late messenger RNA leader
 segments
 JOURNAL Virology 127 (1), 112-123 (1983)
 PUBMED 6857999
REFERENCE 43 (sites)
 AUTHORS Yeh-Kai,L., Akusjarvi,G., Alestrom,P., Pettersson,U., Tremblay,M.
 and Weber,J.
 TITLE Genetic identification of an endoproteinase encoded by the
 adenovirus genome
 JOURNAL J. Mol. Biol. 167 (1), 217-222 (1983)
 PUBMED 6306252
REFERENCE 44 (sites)
 AUTHORS Sung,M.T., Cao,T.M., Lischwe,M.A. and Coleman,R.T.
 TITLE Molecular processing of adenovirus proteins
 JOURNAL J. Biol. Chem. 258 (13), 8266-8272 (1983)
 PUBMED 6336325
REFERENCE 45 (sites)
 AUTHORS Kruijer,W., van Schaik,F.M., Speijer,J.G. and Sussenbach,J.S.
 TITLE Structure and function of adenovirus DNA binding protein:
 comparison of the amino acid sequences of the Ad5 and Ad12 proteins
 derived from the nucleotide sequence of the corresponding genes
 JOURNAL Virology 128 (1), 140-153 (1983)
 PUBMED 6308889
REFERENCE 46 (sites)
 AUTHORS Le Moullec,J.M., Akusjarvi,G., Stalhandske,P., Pettersson,U.,
 Chambraud,B., Gilardi,P., Nasri,M. and Perricaudet,M.
 TITLE Polyadenylic acid addition sites in the adenovirus type 2 major
 late transcription unit
 JOURNAL J. Virol. 48 (1), 127-134 (1983)
 PUBMED 6136617
REFERENCE 47 (sites)
 AUTHORS Tigges,M.A. and Raskas,H.J.
 TITLE Splice junctions in adenovirus 2 early region 4 mRNAs: multiple
 splice sites produce 18 to 24 RNAs
 JOURNAL J. Virol. 50 (1), 106-117 (1984)
 PUBMED 6336328
REFERENCE 48 (sites)
 AUTHORS Downey,J.F., Evelegh,C.M., Branton,P.E. and Bayley,S.T.
 TITLE Peptide maps and N-terminal sequences of polypeptides from early
 region 1A of human adenovirus 5
 JOURNAL J. Virol. 50 (1), 30-37 (1984)
 PUBMED 6699947
REFERENCE 49 (sites)
 AUTHORS Freyer,G.A., Katoh,Y. and Roberts,R.J.
 TITLE Characterization of the major mRNAs from adenovirus 2 early region
 4 by cDNA cloning and sequencing
 JOURNAL Nucleic Acids Res. 12 (8), 3503-3519 (1984)
 PUBMED 6145146
REFERENCE 50 (sites)
 AUTHORS Leff,T., Elkaim,R., Goding,C.R., Jalinot,P., Sassone-Corsi,P.,
 Perricaudet,M., Kedinger,C. and Chambon,P.
 TITLE Individual products of the adenovirus 12S and 13S EIa mRNAs
 stimulate viral EIIa and EIII expression at the transcriptional
  level
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (14), 4381-4385 (1984)
 PUBMED 6336330
REFERENCE 51 (sites)
 AUTHORS Padgett,R.A., Konarska,M.M., Grabowski,P.J., Hardy,S.F. and
 Sharp,P.A.
 TITLE Lariat RNA's as intermediates and products in the splicing of
 messenger RNA precursors
 JOURNAL Science 225 (4665), 898-903 (1984)
 PUBMED 6206566
REFERENCE 52 (sites)
 AUTHORS Natarajan,V., Madden,M.J. and Salzman,N.P.
 TITLE Proximal and distal domains that control in vitro transcription of
 the adenovirus IVa2 gene
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 81 (20), 6290-6294 (1984)
 PUBMED 6593702
REFERENCE 53 (sites)
 AUTHORS Wold,W.S., Cladaras,C., Magie,S.C. and Yacoub,N.
 TITLE Mapping a new gene that encodes an 11,600-molecular-weight protein
 in the E3 transcription unit of adenovirus 2
 JOURNAL J. Virol. 52 (2), 307-313 (1984)
 PUBMED 6492252
REFERENCE 54 (sites)
 AUTHORS Mautner,V. and Mackay,N.
 TITLE Recombination in adenovirus: analysis of crossover sites in
 intertypic overlap recombinants
 JOURNAL Virology 139 (1), 43-52 (1984)
 PUBMED 6495658
REFERENCE 55 (sites)
 AUTHORS Alestrom,P., Akusjarvi,G., Lager,M., Yeh-kai,L. and Pettersson,U.
 TITLE Genes encoding the core proteins of adenovirus type 2
 JOURNAL J. Biol. Chem. 259 (22), 13980-13985 (1984)
 PUBMED 6094534
REFERENCE 56 (sites)
 AUTHORS Roberts,R.J., O'Neill,K.E. and Yen,C.T.
 TITLE DNA sequences from the adenovirus 2 genome
 JOURNAL J. Biol. Chem. 259 (22), 13968-13975 (1984)
 PUBMED 6334081
REFERENCE 57 (sites)
 AUTHORS Moore,C.L. and Sharp,P.A.
 TITLE Accurate cleavage and polyadenylation of exogenous RNA substrate
 JOURNAL Cell 41 (3), 845-855 (1985)
 PUBMED 2408761
REFERENCE 58 (sites)
 AUTHORS Roberts,R.J., Akusjaervi,G., Alestroem,P., Gelinas,R.E.,
 Gingeras,T.R., Sciaky,D. and Pettersson,U.
 TITLE A consensus sequence for the adenovirus-2 genome
 JOURNAL (in) Doerfler,W. (Ed.);
 ADENOVIRUS DNA: 1-51;
 Martinus Nijhoff Publishing, Boston (1986)
REFERENCE 59 (sites)
 AUTHORS Anderson,C.W., Schmitt,R.C., Smart,J.E. and Lewis,J.B.
 TITLE Early region 1B of adenovirus serotype 2 encodes two co-terminal
 proteins of 495 and 155 amino acid residues
 JOURNAL Unpublished (1984)
REFERENCE 60 (sites)
 AUTHORS Virtanen,A. and Pettersson,U.
 JOURNAL Unpublished (1984)
COMMENT [1] RNA.
 [2] sites; cds start for the hexon protein.
 [4] sites; 5' terminus of VA I RNA.
 [6] mRNA and DNA.
 [11] cDNA to hexon mRNA.
 [12] several fragments over this span;.
 [13] mRNA and DNA.
 [19] cDNA.
 [16] sites; acceptor splice site for fiber mRNA.
 [18] several leader fragments over this span.
 [27] sites; splice sites for E1b mRNAs.
 [28] sites; cds start for E3 19K glycoprotein.
 [29] sites; cds start for 15K, IX and fiber polypeptides. [37]
 sites; cap site for E4 mrnas.
 [39] sites; splice sites in E2a mRNA.
 [31] fragments over this span.
 [34] sites; splice site in 52,55K-pept mRNA.
 [30] sites; splice sites in IVa2 mRNA, Ad5.
 [43] cDNA and DNA.
 [42] sites; splice site for 'i' leader.
 [46] mRNA and DNA.
 [41] sites; E1a mutational analysis.
 [55] sites; splice sites for 33K mRNA.
 [56] sites; cds start for E4 11K-pept, ad5.
 [60] sites; cds start for the 13.6K-pept.
 [61] sites; splice sites for 72K and 100K mRNAs.
 [50] sites; splice sites for leaders; poly-A sites. [52] sites;
 splice sites for E1a mRNAs.
 [58] sites; splice sites in E2 mRNA.
 [53] sites; H2ts1 mutation between 57.0% and 69.0%. [49] H2ts125
 strain.
 [68] sites; cds start for E1a proteins.
 [69] sites; splice sites in E4 region.
 [71] sites; splice sites in E4 region; poly-A site for E4 mRNAs.
 [63] sites; cds start for 57K-pept.
 [63] sites; splice sites in E4 region; poly-A site for E4 mRNAs.
 [63] sites; splice sites in E1b region.
 [(in) Doerfler,W. (Ed.);Adenovirus DNA: 1-51;Martinus Nijhoff
 Publishing, Boston ] review; bases 1 to 35937.
 [75] sites; recombination analysis of ad2 and ad5. [74] sites;
 splice sites in major late mRNA.
 [73] sites; IVa2 transcription start.
 [72] sites; transcription start for EIa mRNAs.
 [70] sites; E3 11.6 -K protein.
 [76] sites; L3 mRNA polyadenylation site.
 [78] sites; L3 mRNA polyadenylation site.
 Communicated on tape by R. Roberts. That tape and [(in) Doerfler,
  W. (Ed.);Adenovirus DNA: 1-51;Martinus Nijhoff Publishing, Boston ]
 are the
 immediate sources of the annotation herein.
 A consensus sequence for the l-strand of the genome is shown.
 Population heterogeneity as distinct from strain variation is known
 (35937 +/- 9 bp) [67]; both are annotated as 'variation' below. For
 site differences with adenovirus type 5, see loci beginning <ad5>
 which are arranged in the library according to the map coordinates
 of <ad2> where one map unit corresponds to 360 bases throughout
 (see [44],[67]). For mutational changes in the ad2 sequence, see
 the appropriate references above.
 The origin of replication is located in the first fifty bases from
 each end.
 Transcription is leftward off the l-strand and rightward off the
 r-strand; in the former case, the annotation shows '(c)' for
 complementary strand. Complex splicing events give rise to perhaps
 fifty or more distinct mRNA transcripts at early, intermediate and
 late times after infection, many of which are still being
 characterized; in particular, some transcripts are known from
 electron microscopy which are not yet characterized at the sequence
 level. To date nine mRNA start sites (cap sites) have been
 identified, and these define the general units of mRNAs under which
 all known transcripts are classified.
 From the r-strand, the early transcripts are E1a, E1b and E3. The
 28 kb late transcript called herein 'major late mRNA' comprises
 five families, L1 through L5, of 3' co-terminal mRNAs. L1, and to
 a lesser extent L2, can be expressed at early and intermediate
 times [34]. Transcripts from this region contain a common
 tripartite leader sequence at their 5' ends: the three segments of
 this leader are encoded at bases 6039-6079, 7101-7172 and
 9634-9723. At early and intermediate times, an extra leader
 segment, the 'i' leader, is frequently present (bases 7942-8381).
 The IX message, the only unspliced message in ad2, is intermediate,
 and its termination overlaps that for E1b on the same strand and
 that for IVa2, and most likely E2b, on the opposite strand. From
 the l-strand, or the 'comp strand', early expression derives from
 the E2a, E2b and E4 families of mRNAs, although there can be late
 transcription from E2a. The E2b cap sites, splice sites and
 termination sites have not been determined at the sequence level.
 From electron microscopy there is evidence that the E2b mRNAs may
 originate at the E2a early cap site at 27092 (c) and terminate at
 the poly-A addition site found for the IVa2 mRNA at 4050 (c) [44].
 IVa2 is an intermediate message. The promoters for these nine
 classes of mRNAs can be localized and characterized to the
 following extent [32]:
 mRNA cap site possible promoter region
 ------ ---------- -----------------------------
 E1a 498 tatttata at 468-474
 E1b 1699 tatataat at 1669-1676
 IX 3576 tatataa at 3545-3551
 major late 6039 tataaaa at 6008-6014
 E3 27609 tataa at 27580-27584
 E4 35609 (c) tatatata at 35641-35633 (c)
 E2a early 27092 (c) no obvious sequence for 100 bases
  upstream
 E2a late 25956 (c) tacaaattt at 25985-25977 (c)
 IVa2 5826 (c) no obvious sequence for 100 bases
 upstream
  The mRNA responsible for the 13.6K protein encoded at 7968 has not
 been identified. The VA I and VA II transcripts are unique in that
 they are generated by RNA polymerase III; for a discussion of these
 low molecular weight RNAs-- the modulation of their start points,
 their promoters, their heterogeneity and their similarity to tRNA--
 see [3],[4],[5],[26] and <ad5a2>.
 The proteins known to be encoded from these mRNAs are given in the
 Features table below, though the details of translation and
 processing have not been fully determined. In cases such as the
 IIIa peptide or the 11K peptide, the exact span of the coding
 awaits elucidation of the mRNA splicing. Some of these products
 share reading frames and therefore manifest partial homologies. The
 following table summarizes the unidentified reading frames ('URF')
 of 100 or more amino acids:
  initiator terminator frame protein encoded
 ----------- ---------- ------- -----------------
 6280 6600 1 11.6K URF
 17284 17763 1 17.4K URF
 23782 24138 1 12.9K URF
 24481 24867 1 14.2K URF
 26044 26826 1 28.6K URF(contains the
  N-terminus of 33K cds)
 30973 32778 1 63.9K URF(contains the
 fiber cds)
 10421 10834 2 14.4K URF
 20504 20935 2 15.7K URF
 27899 28222 2 12.4K URF
 30059 30451 2 14.5k URF
 33956 34456 2 18.8K URF
 9294 9800 3 17.7K URF
 23526 26525 3 110.2K URF(contains the
 100K-pept cds)
 30444 30830 3 14.7K URF
  34470 34808 3 12.7K URF
 complementary strand
 ---------------------------
 35532 35146 1 14.3K URF
 34077 33193 1  34.1K URF
 11109 10744 1 12.8K URF
 9030 8383 1 22.8K URF
 6780 6442 1 12.8K URF
 31604 31290 2  10.7K URF
 31211 30852 2 13.5K URF
 18707 18159 2 18.9K URF
 14861 14424 2 16.4K URF
 14114 13728 2  13.5K URF
 11618 11250 2 13.6K URF
  1712 1194 2 18.1K URF
 35113 34703 3 15.3K URF
 34342 33998 3 13.3K URF
 5674 5327 3 12.2K URF Additionally
 there are numerous unidentified reading frames of less than 100
 amino acid residues; and further small modifications of a few of
 the coding sequences are possible.
 [7] missing data project.
FEATURES Location/Qualifiers
 source  1..3171
 /organism="Human adenovirus 2"
 /mol_type="genomic DNA"
 /db_xref="taxon:10515"
 gene complement(<1..>3171)
 /gene="E2b"
 mRNA complement(<1..>3171)
 /gene="E2b"
 /citation=[32]
 prim_transcript complement(<1..640)
 /gene="IVa2"
 /citation=[32]
 gene complement(<1..509)
 /gene="IVa2"
 CDS complement(join(<1..231,510..522))
 /gene="IVa2"
 /codon_start=1
 /product="virion morphogenesis-associated protein"
  /protein_id="AAA92205.1"
 /db_xref="GI:209817"
 /translation="METRGRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPA
 PVERHDPGPSGRAPTTAVQRKPPQPAKRGDMLDRDAVEHVTELWDRLELLGQTLKSMP
 TADGLKPLKNFASLQELLSLGGERLLAHLVRENMQVRDMLNEVAPLLRDDGSCSSLNY
 QLQPVIGVIYGPTGCGKSQLLRNLLSSQLISPTPETVFFIAPQVDMIPPSELKAWEMQ
 ICEGNYAPGPDGTIIPQSGTLRPRFVKMAYDDLILEHNYDVSDPRNIFAQAAARGPIA
 IIMDECMENLGGHKGVSKFFHAFPSKLHDKFPKCTGYTVLVVLHNMNPRRDMAGNIAN
 LKIQSKMHLISPRMHPSQLNRFVNTYTKGLPLAISLLLKDIFRHHAQRSCYDWIIYNT
 TPQHEALQWCYLHPRDGLMPMYLNIQSHLYHVLEKIHRTLNDRDRWSRAYRARKTPK"
 CDS complement(1..3171)
 /gene="DNA polymerase"
 /codon_start=1
 /product="DNA polymerase"
 /protein_id="AAA92206.1"
 /db_xref="GI:209822"
 /translation="MDSSHLRDVVIKLRPPRADIWTLGSRGVVVRSTITPLEQPDGQG
 QAAEVEDHQPNPPGEGLKFPLCFLVRGRQVNLVQDVQPVHRCQYCARFYKSQHECSAR
 RRDFYFHHINSHSSNWWREIQFFPIGSHPRTERLFVTYDVETYTWMGAFGKQLVPFML
 VMKFGGDEPLVTAARDLAVDLGWDRWEQDPLTFYCITPEKMAIGRQFRTFRDHLQMLM
 ARDLWSSFVASNPHLADWALSEHGLSSPEELTYEELKKLPSIKGTPRFLELYIVGHNI
 NGFDEIVLAAQVINNRSEVPGPFRITRNFMPRAGKILFNDVTFALPNPRSKKRTDFLL
 WEQGGCDDTDFKYQYLKVMVRDTFALTHTSLRKAAQAYALPVEKGCCAYQAVNQFYML
 GSYRSEADGFPIQEYWKDREEFVLNRELWKKKGQDKYDIIKETLDYCALDVQVTAELV
 NKLRDSYASFVRDAVGLTDASFNVFQRPTISSNSHAIFRQIVFRAEQPARSNLGPDLL
 APSHELYDYVRASIRGGRCYPTYLGILREPLYVYDICGMYASALTHPMPWGPPLNPYE
 RALAARAWQQALDLQGCKIDYFDARLLPGVFTVDADPPDETQLDPLPPFCSRKGGRLC
  WTNERLRGEVATSVDLVTLHNRGWRVHLVPDERTTVFPEWRCVAREYVQLNIAAKERA
 DRDKNQTLRSIAKLLSNALYGSFATKLDNKKIVFSDQMDAATLKGITAGQVNIKSSSF
 LETDNLSAEVMPAFEREYSPQQLALADSDAEESEDERAPTPFYSPPSGTPGHVAYTYK
 PITFLDAEEGDMCLHTLERVDPLVDNDRYPSHLASFVLAWTRAFVSEWSEFLYEEDRG
 TPLEDRPLKSVYGDTDSLFVTERGHRLMETRGKKRIKKHGGNLVFDPERPELTWLVEC
 ETVCGACGADAYSPESVFLAPKLYALKSLHCPSCGASSKGKLRAKGHAAEGLDYDTMV
 KCYLADAQGEDRQRFSTSRTSLKRTLASAQPGAHPFTVTQTTLTRTLRPWKDMTLARL
 DEHRLLPYSESRPNPRNEEICWIEMP"
 gene complement(1..2027)
 /gene="DNA polymerase"
 intron complement(232..509)
 /gene="IVa2"
  /citation=[17]
 prim_transcript 853..>3171
 /citation=[25]
 gene 853..>3171
 /gene="L5"
 prim_transcript 853..>3171
 /gene="L4"
 /citation=[25]
 gene 853..>3171
 /gene="L4"
 prim_transcript 853..>3171
 /gene="L4"
 /citation=[22]
 gene 853..>3171
 /gene="L3_1"
 prim_transcript 853..>3171
 /gene="L3_1"
  /citation=[24]
 gene 853..>3171
 /gene="L2_1"
 prim_transcript 853..>3171
 /gene="L1"
  /citation=[25]
 gene 853..>3171
 /gene="L1"
 intron 894..1914
 /gene="L1"
  /note="major late mRNA intron (precedes 2nd leader)"
 /citation=[8]
 old_sequence 1257
 /gene="L1"
 /citation=[15]
 conflict 1388..1389
 /gene="L1"
 /citation=[15]
 /replace=""
 intron 1987..2755
 /gene="DNA polymerase"
 /note="major late mRNA intron (precedes 'i' leader)"
 /citation=[8]
 old_sequence 2026..2027
 /gene="L1"
 /citation=[14]
 CDS 2782..>3171
 /gene="L1"
 /codon_start=1
 /product="13.6 kD protein"
  /protein_id="AAA92207.1"
 /db_xref="GI:209823"
 /translation="MRADREELDLPPPVGGVAVDVVKVEVPATGRTLVLAFVKTCAVL
  AAVHGLYILHEVDLTTAHKEAEWEFEPLAWRVWLVVFYFGCLSLTVWLLEGSYGGSDH
 HAARAQSPDVRARRSELDDNIAQMGAVHGLELPRRQVRRELLQVYLA"
ORIGIN 
 1 ctacggcatc tcgatccagc atatctcctc gtttcgcggg ttggggcggc tttcgctgta
 61 cggcagtagt cggtgctcgt ccagacgggc cagggtcatg tctttccacg ggcgcagggt
 121 cctcgtcagc gtagtctggg tcacggtgaa ggggtgcgct ccgggctgcg cgctggccag
 181 ggtgcgcttg aggctggtcc tgctggtgct gaagcgctgc cggtcttcgc cctgcgcgtc
 241 ggccaggtag catttgacca tggtgtcata gtccagcccc tccgcggcgt ggcccttggc
 301 gcgcagcttg cccttggagg aggcgccgca cgaggggcag tgcagacttt taagggcgta
 361 gagcttgggc gcgagaaata ccgattccgg ggagtaggca tccgcgccgc aggccccgca
 421 gacggtctcg cattccacga gccaggtgag ctctggccgt tcggggtcaa aaaccaggtt
 481 tcccccatgc tttttgatgc gtttcttacc tctggtttcc atgagccggt gtccacgctc
 541 ggtgacgaaa aggctgtccg tgtccccgta tacagacttg agaggcctgt cctcgagcgg
 601 tgttccgcgg tcctcctcgt atagaaactc ggaccactct gagacgaagg ctcgcgtcca
 661 ggccagcacg aaggaggcta agtgggaggg gtagcggtcg ttgtccacta gggggtccac
 721 tcgctccagg gtgtgaagac acatgtcgcc ctcttcggca tcaaggaagg tgattggttt
 781 ataggtgtag gccacgtgac cgggtgttcc tgaagggggg ctataaaagg gggtgggggc
 841 gcgttcgtcc tcactctctt ccgcatcgct gtctgcgagg gccagctgtt ggggtgagta
 901 ctccctctca aaagcgggca tgacttctgc gctaagattg tcagtttcca aaaacgagga
 961 ggatttgata ttcacctggc ccgcggtgat gcctttgagg gtggccgcgt ccatctggtc
 1021 agaaaagaca atctttttgt tgtcaagctt ggtggcaaac gacccgtaga gggcgttgga
 1081 cagcaacttg gcgatggagc gcagggtttg gtttttgtcg cgatcggcgc gctccttggc
 1141 cgcgatgttt agctgcacgt attcgcgcgc aacgcaccgc cattcgggaa agacggtggt
 1201 gcgctcgtcg ggcaccaggt gcacgcgcca accgcggttg tgcagggtga caaggtcaac
 1261 gctggtggct acctctccgc gtaggcgctc gttggtccag cagaggcggc cgcccttgcg
 1321 cgaacagaat ggcggtagtg ggtctagctg cgtctcgtcc ggggggtctg cgtccacggt
 1381 aaagaccccg ggcagcaggc gcgcgtcgaa gtagtctatc ttgcatcctt gcaagtctag
 1441 cgcctgctgc catgcgcggg cggcaagcgc gcgctcgtat gggttgagtg ggggacccca
 1501 tggcatgggg tgggtgagcg cggaggcgta catgccgcaa atgtcgtaaa cgtagagggg
 1561 ctctctgagt attccaagat atgtagggta gcatcttcca ccgcggatgc tggcgcgcac
 1621 gtaatcgtat agttcgtgcg agggagcgag gaggtcggga ccgaggttgc tacgggcggg
 1681 ctgctctgct cggaagacta tctgcctgaa gatggcatgt gagttggatg atatggttgg
 1741 acgctggaag acgttgaagc tggcgtctgt gagacctacc gcgtcacgca cgaaggaggc
 1801 gtaggagtcg cgcagcttgt tgaccagctc ggcggtgacc tgcacgtcta gggcgcagta
 1861 gtccagggtt tccttgatga tgtcatactt atcctgtccc ttttttttcc acagctcgcg
 1921 gttgaggaca aactcttcgc ggtctttcca gtactcttgg atcggaaacc cgtcggcctc
 1981 cgaacggtaa gagcctagca tgtagaactg gttgacggcc tggtaggcgc agcatccctt
 2041 ttctacgggt agcgcgtatg cctgcgcggc cttccggagc gaggtgtggg tgagcgcaaa
  2101 ggtgtcccta accatgactt tgaggtactg gtatttgaag tcagtgtcgt cgcatccgcc
 2161 ctgctcccag agcaaaaagt ccgtgcgctt tttggaacgc gggtttggca gggcgaaggt
 2221 gacatcgttg aaaagtatct ttcccgcgcg aggcataaag ttgcgtgtga tgcggaaggg
 2281 tcccggcacc tcggaacggt tgttaattac ctgggcggcg agcacgatct cgtcgaagcc
 2341 gttgatgttg tggcccacga tgtaaagttc caagaagcgc ggggtgccct tgatggaggg
 2401 caatttttta agttcctcgt aggtgagctc ctcaggggag ctgagcccgt gttctgacag
 2461 ggcccagtct gcaagatgag ggttggaagc gacgaatgag ctccacaggt cacgggccat
 2521 tagcatttgc aggtggtcgc gaaaggtcct aaactggcga cctatggcca ttttttctgg
 2581 ggtgatgcag tagaaggtaa gcgggtcttg ttcccagcgg tcccatccaa ggtccacggc
 2641 taggtctcgc gcggcggtca ccagaggctc atctccgccg aacttcataa ccagcatgaa
 2701 gggcacgagc tgcttcccaa aggcccccat ccaagtatag gtctctacat cgtaggtgac
 2761 aaagagacgc tcggtgcgag gatgcgagcc gatcgggaag aactggatct cccgccacca
 2821 gttggaggag tggctgttga tgtggtgaaa gtagaagtcc ctgcgacggg ccgaacactc
 2881 gtgctggctt ttgtaaaaac gtgcgcagta ctggcagcgg tgcacgggct gtacatcctg
 2941 cacgaggttg acctgacgac cgcgcacaag gaagcagagt gggaatttga gcccctcgcc
 3001 tggcgggttt ggctggtggt cttctacttc ggctgcttgt ccttgaccgt ctggctgctc
 3061 gaggggagtt atggtggatc ggaccaccac gccgcgcgag cccaaagtcc agatgtccgc
 3121 gcgcggcggt cggagcttga tgacaacatc gcgcagatgg gagctgtcca t
//