LOCUS AC_000008 1248 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 11050..12297
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 1248)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 1248)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 1248)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN  COMP
 1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..1248
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
  /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..1248
  /codon_start=1
 /product="52K"
 /protein_id="AP_000204.1"
 /db_xref="GI:56160537"
 /translation="MHPVLRQMRPPPQQRQEQEQRQTCRAPSPPPTASGGATSAVDAA
 ADGDYEPPRRRARHYLDLEEGEGLARLGAPSPERYPRVQLKRDTREAYVPRQNLFRDR
 EGEEPEEMRDRKFHAGRELRHGLNRERLLREEDFEPDARTGISPARAHVAAADLVTAY
 EQTVNQEINFQKSFNNHVRTLVAREEVAIGLMHLWDFVSALEQNPNSKPLMAQLFLIV
 QHSRDNEAFRDALLNIVEPEGRWLLDLINILQSIVVQERSLSLADKVAAINYSMLSLG
 KFYARKIYHTPYVPIDKEVKIEGFYMRMALKVLTLSDDLGVYRNERIHKAVSVSRRRE
 LSDRELMHSLQRALAGTGSGDREAESYFDAGADLRWAPSRRALEAAGAGPGLAVAPAR
 AGNVGGVEEYDEDDEYEPEDGEY"
ORIGIN 
 1 atgcatccgg tgctgcggca gatgcgcccc cctcctcagc agcggcaaga gcaagagcag
 61 cggcagacat gcagggcacc ctcccctcct cctaccgcgt caggaggggc gacatccgcg
 121 gttgacgcgg cagcagatgg tgattacgaa cccccgcggc gccgggcccg gcactacctg
 181 gacttggagg agggcgaggg cctggcgcgg ctaggagcgc cctctcctga gcggtaccca
 241 agggtgcagc tgaagcgtga tacgcgtgag gcgtacgtgc cgcggcagaa cctgtttcgc
 301 gaccgcgagg gagaggagcc cgaggagatg cgggatcgaa agttccacgc agggcgcgag
 361 ctgcggcatg gcctgaatcg cgagcggttg ctgcgcgagg aggactttga gcccgacgcg
 421 cgaaccggga ttagtcccgc gcgcgcacac gtggcggccg ccgacctggt aaccgcatac
 481 gagcagacgg tgaaccagga gattaacttt caaaaaagct ttaacaacca cgtgcgtacg
 541 cttgtggcgc gcgaggaggt ggctatagga ctgatgcatc tgtgggactt tgtaagcgcg
 601 ctggagcaaa acccaaatag caagccgctc atggcgcagc tgttccttat agtgcagcac
 661 agcagggaca acgaggcatt cagggatgcg ctgctaaaca tagtagagcc cgagggccgc
 721 tggctgctcg atttgataaa catcctgcag agcatagtgg tgcaggagcg cagcttgagc
 781 ctggctgaca aggtggccgc catcaactat tccatgctta gcctgggcaa gttttacgcc
 841 cgcaagatat accatacccc ttacgttccc atagacaagg aggtaaagat cgaggggttc
 901 tacatgcgca tggcgctgaa ggtgcttacc ttgagcgacg acctgggcgt ttatcgcaac
 961 gagcgcatcc acaaggccgt gagcgtgagc cggcggcgcg agctcagcga ccgcgagctg
 1021 atgcacagcc tgcaaagggc cctggctggc acgggcagcg gcgatagaga ggccgagtcc
 1081 tactttgacg cgggcgctga cctgcgctgg gccccaagcc gacgcgccct ggaggcagct
 1141 ggggccggac ctgggctggc ggtggcaccc gcgcgcgctg gcaacgtcgg cggcgtggag
 1201 gaatatgacg aggacgatga gtacgagcca gaggacggcg agtactaa
//