LOCUS AC_000008 870 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: join(560..1112,1229..1545)
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 870)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 870)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 870)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN  COMP
 1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..870
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
  /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..870
  /note="other spliced forms exist with larger introns"
 /codon_start=1
 /product="E1A"
 /protein_id="AP_000197.1"
 /db_xref="GI:56160530"
 /translation="MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLH
 ELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQP
 EQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYH
 RRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPT
 SPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEP
 GQPLDLSCKRPRP"
ORIGIN 
 1 atgagacata ttatctgcca cggaggtgtt attaccgaag aaatggccgc cagtcttttg
 61 gaccagctga tcgaagaggt actggctgat aatcttccac ctcctagcca ttttgaacca
 121 cctacccttc acgaactgta tgatttagac gtgacggccc ccgaagatcc caacgaggag
 181 gcggtttcgc agatttttcc cgactctgta atgttggcgg tgcaggaagg gattgactta
 241 ctcacttttc cgccggcgcc cggttctccg gagccgcctc acctttcccg gcagcccgag
 301 cagccggagc agagagcctt gggtccggtt tctatgccaa accttgtacc ggaggtgatc
 361 gatcttacct gccacgaggc tggctttcca cccagtgacg acgaggatga agagggtgag
 421 gagtttgtgt tagattatgt ggagcacccc gggcacggtt gcaggtcttg tcattatcac
 481 cggaggaata cgggggaccc agatattatg tgttcgcttt gctatatgag gacctgtggc
 541 atgtttgtct acagtcctgt gtctgaacct gagcctgagc ccgagccaga accggagcct
 601 gcaagaccta cccgccgtcc taaaatggcg cctgctatcc tgagacgccc gacatcacct
 661 gtgtctagag aatgcaatag tagtacggat agctgtgact ccggtccttc taacacacct
 721 cctgagatac acccggtggt cccgctgtgc cccattaaac cagttgccgt gagagttggt
 781 gggcgtcgcc aggctgtgga atgtatcgag gacttgctta acgagcctgg gcaacctttg
 841 gacttgagct gtaaacgccc caggccataa
//