LOCUS AC_000008 324 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 27858..28181
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 324)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 324)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 324)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
  It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35938  M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..324
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
 /serotype="Human adenovirus type 5"
  /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..324
 /codon_start=1
  /product="E3 12.5K"
 /protein_id="AP_000218.1"
 /db_xref="GI:56160551"
 /translation="MLSGEAEQLRLKHLVHCRRHKCFARDSGEFCYFELPEDHIEGPA
 HGVRLTAQGELARSLIREFTQRPLLVERDRGPCVLTVICNCPNLGLHQDLCCHLCAEY
 NKYRN"
ORIGIN 
 1 atgttaagtg gagaggcaga gcaactgcgc ctgaaacacc tggtccactg tcgccgccac
 61 aagtgctttg cccgcgactc cggtgagttt tgctactttg aattgcccga ggatcatatc
 121 gagggcccgg cgcacggcgt ccggcttacc gcccagggag agcttgcccg tagcctgatt
 181 cgggagttta cccagcgccc cctgctagtt gagcgggaca ggggaccctg tgttctcact
 241 gtgatttgca actgtcctaa ccttggatta catcaagatc tttgttgcca tctctgtgct
 301 gagtataata aatacagaaa ttaa
//