LOCUS AC_000008 1716 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 14156..15871
VERSION  AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 1716)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 1716)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE  The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 1716)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..1716
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
 /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..1716
 /codon_start=1
 /product="III"
 /protein_id="AP_000206.1"
  /db_xref="GI:56160539"
 /translation="MRRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPR
 YLRPTGGRNSIRYSELAPLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYS
 PGEASTQTINLDDRSHWGGDLKTILHTNMPNVNEFMFTNKFKARVMVSRLPTKDNQVE
 LKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLG
 FDPVTGLVMPGVYTNEAFHPDIILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYD
 DLEGGNIPALLDVDAYQASLKDDTEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDM
 NDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLTEDSKKRSYN
 LISNDSTFTQYRSWYLAYNYGDPQTGIRSWTLLCTPDVTCGSEQVYWSLPDMMQDPVT
 FRSTRQISNFPVVGAELLPVHSKSFYNDQAVYSQLIRQFTSLTHVFNRFPENQILARP
 PAPTITTVSENVPALTDHGTLPLRNSIGGVQRVTITDARRRTCPYVYKALGIVSPRVL
 SSRTF"
ORIGIN 
 1 atgcggcgcg cggcgatgta tgaggaaggt cctcctccct cctacgagag tgtggtgagc
 61 gcggcgccag tggcggcggc gctgggttct cccttcgatg ctcccctgga cccgccgttt
 121 gtgcctccgc ggtacctgcg gcctaccggg gggagaaaca gcatccgtta ctctgagttg
 181 gcacccctat tcgacaccac ccgtgtgtac ctggtggaca acaagtcaac ggatgtggca
 241 tccctgaact accagaacga ccacagcaac tttctgacca cggtcattca aaacaatgac
 301 tacagcccgg gggaggcaag cacacagacc atcaatcttg acgaccggtc gcactggggc
 361 ggcgacctga aaaccatcct gcataccaac atgccaaatg tgaacgagtt catgtttacc
 421 aataagttta aggcgcgggt gatggtgtcg cgcttgccta ctaaggacaa tcaggtggag
 481 ctgaaatacg agtgggtgga gttcacgctg cccgagggca actactccga gaccatgacc
 541 atagacctta tgaacaacgc gatcgtggag cactacttga aagtgggcag acagaacggg
 601 gttctggaaa gcgacatcgg ggtaaagttt gacacccgca acttcagact ggggtttgac
 661 cccgtcactg gtcttgtcat gcctggggta tatacaaacg aagccttcca tccagacatc
 721 attttgctgc caggatgcgg ggtggacttc acccacagcc gcctgagcaa cttgttgggc
 781 atccgcaagc ggcaaccctt ccaggagggc tttaggatca cctacgatga tctggagggt
 841 ggtaacattc ccgcactgtt ggatgtggac gcctaccagg cgagcttgaa agatgacacc
 901 gaacagggcg ggggtggcgc aggcggcagc aacagcagtg gcagcggcgc ggaagagaac
 961 tccaacgcgg cagccgcggc aatgcagccg gtggaggaca tgaacgatca tgccattcgc
 1021 ggcgacacct ttgccacacg ggctgaggag aagcgcgctg aggccgaagc agcggccgaa
 1081 gctgccgccc ccgctgcgca acccgaggtc gagaagcctc agaagaaacc ggtgatcaaa
 1141 cccctgacag aggacagcaa gaaacgcagt tacaacctaa taagcaatga cagcaccttc
 1201 acccagtacc gcagctggta ccttgcatac aactacggcg accctcagac cggaatccgc
 1261 tcatggaccc tgctttgcac tcctgacgta acctgcggct cggagcaggt ctactggtcg
 1321 ttgccagaca tgatgcaaga ccccgtgacc ttccgctcca cgcgccagat cagcaacttt
 1381 ccggtggtgg gcgccgagct gttgcccgtg cactccaaga gcttctacaa cgaccaggcc
 1441 gtctactccc aactcatccg ccagtttacc tctctgaccc acgtgttcaa tcgctttccc
 1501 gagaaccaga ttttggcgcg cccgccagcc cccaccatca ccaccgtcag tgaaaacgtt
 1561 cctgctctca cagatcacgg gacgctaccg ctgcgcaaca gcatcggagg agtccagcga
 1621 gtgaccatta ctgacgccag acgccgcacc tgcccctacg tttacaaggc cctgggcata
 1681 gtctcgccgc gcgtcctatc gagccgcact ttttga
//