LOCUS AC_000008 1107 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 16544..17650
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 1107)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 1107)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE  The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 1107)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
  1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..1107
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
 /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..1107
  /codon_start=1
 /product="V"
 /protein_id="AP_000208.1"
 /db_xref="GI:56160541"
 /translation="MSKRKIKEEMLQVIAPEIYGPPKKEEQDYKPRKLKRVKKKKKDD
 DDELDDEVELLHATAPRRRVQWKGRRVKRVLRPGTTVVFTPGERSTRTYKRVYDEVYG
 DEDLLEQANERLGEFAYGKRHKDMLALPLDEGNPTPSLKPVTLQQVLPALAPSEEKRG
 LKRESGDLAPTVQLMVPKRQRLEDVLEKMTVEPGLEPEVRVRPIKQVAPGLGVQTVDV
 QIPTTSSTSIATATEGMETQTSPVASAVADAAVQAVAAAASKTSTEVQTDPWMFRVSA
 PRRPRGSRKYGAASALLPEYALHPSIAPTPGYRGYTYRPRRRATTRRRTTTGTRRRRR
 RRQPVLAPISVRRVAREGGRTLVLPTARYHPSIV"
ORIGIN  
 1 atgtccaagc gcaaaatcaa agaagagatg ctccaggtca tcgcgccgga gatctatggc
 61 cccccgaaga aggaagagca ggattacaag ccccgaaagc taaagcgggt caaaaagaaa
 121 aagaaagatg atgatgatga acttgacgac gaggtggaac tgctgcacgc taccgcgccc
 181 aggcgacggg tacagtggaa aggtcgacgc gtaaaacgtg ttttgcgacc cggcaccacc
 241 gtagtcttta cgcccggtga gcgctccacc cgcacctaca agcgcgtgta tgatgaggtg
 301 tacggcgacg aggacctgct tgagcaggcc aacgagcgcc tcggggagtt tgcctacgga
 361 aagcggcata aggacatgct ggcgttgccg ctggacgagg gcaacccaac acctagccta
 421 aagcccgtaa cactgcagca ggtgctgccc gcgcttgcac cgtccgaaga aaagcgcggc
 481 ctaaagcgcg agtctggtga cttggcaccc accgtgcagc tgatggtacc caagcgccag
 541 cgactggaag atgtcttgga aaaaatgacc gtggaacctg ggctggagcc cgaggtccgc
  601 gtgcggccaa tcaagcaggt ggcgccggga ctgggcgtgc agaccgtgga cgttcagata
 661 cccactacca gtagcaccag tattgccacc gccacagagg gcatggagac acaaacgtcc
 721 ccggttgcct cagcggtggc ggatgccgcg gtgcaggcgg tcgctgcggc cgcgtccaag
 781 acctctacgg aggtgcaaac ggacccgtgg atgtttcgcg tttcagcccc ccggcgcccg
 841 cgcggttcga ggaagtacgg cgccgccagc gcgctactgc ccgaatatgc cctacatcct
 901 tccattgcgc ctacccccgg ctatcgtggc tacacctacc gccccagaag acgagcaact
 961 acccgacgcc gaaccaccac tggaacccgc cgccgccgtc gccgtcgcca gcccgtgctg
 1021 gccccgattt ccgtgcgcag ggtggctcgc gaaggaggca ggaccctggt gctgccaaca
 1081 gcgcgctacc accccagcat cgtttaa
//