LOCUS AC_000008 1758 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 12318..14075
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 1758)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 1758)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 1758)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN  COMP
 1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..1758
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
  /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..1758
  /codon_start=1
 /product="pIIIa"
 /protein_id="AP_000205.1"
 /db_xref="GI:56160538"
 /translation="MMQDATDPAVRAALQSQPSGLNSTDDWRQVMDRIMSLTARNPDA
 FRQQPQANRLSAILEAVVPARANPTHEKVLAIVNALAENRAIRPDEAGLVYDALLQRV
 ARYNSGNVQTNLDRLVGDVREAVAQRERAQQQGNLGSMVALNAFLSTQPANVPRGQED
 YTNFVSALRLMVTETPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLQGLWGVRAPT
 GDRATVSSLLTPNSRLLLLLIAPFTDSGSVSRDTYLGHLLTLYREAIGQAHVDEHTFQ
 EITSVSRALGQEDTGSLEATLNYLLTNRRQKIPSLHSLNSEEERILRYVQQSVSLNLM
 RDGVTPSVALDMTARNMEPGMYASNRPFINRLMDYLHRAAAVNPEYFTNAILNPHWLP
 PPGFYTGGFEVPEGNDGFLWDDIDDSVFSPQPQTLLELQQREQAEAALRKESFRRPSS
 LSDLGAAAPRSDASSPFPSLIGSLTSTRTTRPRLLGEEEYLNNSLLQPQREKNLPPAF
 PNNGIESLVDKMSRWKTYAQEHRDVPGPRPPTRRQRHDRQRGLVWEDDDSADDSSVLD
 LGGSGNPFAHLRPRLGRMF"
ORIGIN 
 1 atgatgcaag acgcaacgga cccggcggtg cgggcggcgc tgcagagcca gccgtccggc
 61 cttaactcca cggacgactg gcgccaggtc atggaccgca tcatgtcgct gactgcgcgc
 121 aatcctgacg cgttccggca gcagccgcag gccaaccggc tctccgcaat tctggaagcg
 181 gtggtcccgg cgcgcgcaaa ccccacgcac gagaaggtgc tggcgatcgt aaacgcgctg
 241 gccgaaaaca gggccatccg gcccgacgag gccggcctgg tctacgacgc gctgcttcag
 301 cgcgtggctc gttacaacag cggcaacgtg cagaccaacc tggaccggct ggtgggggat
 361 gtgcgcgagg ccgtggcgca gcgtgagcgc gcgcagcagc agggcaacct gggctccatg
 421 gttgcactaa acgccttcct gagtacacag cccgccaacg tgccgcgggg acaggaggac
 481 tacaccaact ttgtgagcgc actgcggcta atggtgactg agacaccgca aagtgaggtg
 541 taccagtctg ggccagacta ttttttccag accagtagac aaggcctgca gaccgtaaac
 601 ctgagccagg ctttcaaaaa cttgcagggg ctgtgggggg tgcgggctcc cacaggcgac
 661 cgcgcgaccg tgtctagctt gctgacgccc aactcgcgcc tgttgctgct gctaatagcg
 721 cccttcacgg acagtggcag cgtgtcccgg gacacatacc taggtcactt gctgacactg
 781 taccgcgagg ccataggtca ggcgcatgtg gacgagcata ctttccagga gattacaagt
 841 gtcagccgcg cgctggggca ggaggacacg ggcagcctgg aggcaaccct aaactacctg
 901 ctgaccaacc ggcggcagaa gatcccctcg ttgcacagtt taaacagcga ggaggagcgc
 961 attttgcgct acgtgcagca gagcgtgagc cttaacctga tgcgcgacgg ggtaacgccc
 1021 agcgtggcgc tggacatgac cgcgcgcaac atggaaccgg gcatgtatgc ctcaaaccgg
 1081 ccgtttatca accgcctaat ggactacttg catcgcgcgg ccgccgtgaa ccccgagtat
 1141 ttcaccaatg ccatcttgaa cccgcactgg ctaccgcccc ctggtttcta caccggggga
 1201 ttcgaggtgc ccgagggtaa cgatggattc ctctgggacg acatagacga cagcgtgttt
 1261 tccccgcaac cgcagaccct gctagagttg caacagcgcg agcaggcaga ggcggcgctg
 1321 cgaaaggaaa gcttccgcag gccaagcagc ttgtccgatc taggcgctgc ggccccgcgg
 1381 tcagatgcta gtagcccatt tccaagcttg atagggtctc ttaccagcac tcgcaccacc
 1441 cgcccgcgcc tgctgggcga ggaggagtac ctaaacaact cgctgctgca gccgcagcgc
 1501 gaaaaaaacc tgcctccggc atttcccaac aacgggatag agagcctagt ggacaagatg
 1561 agtagatgga agacgtacgc gcaggagcac agggacgtgc caggcccgcg cccgcccacc
 1621 cgtcgtcaaa ggcacgaccg tcagcggggt ctggtgtggg aggacgatga ctcggcagac
 1681 gacagcagcg tcctggattt gggagggagt ggcaacccgt ttgcgcacct tcgccccagg
 1741 ctggggagaa tgttttaa
//