LOCUS AC_000008 753 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 18003..18755
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 753)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 753)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 753)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
 It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN  COMP
 1-35938 M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..753
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
  /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..753
  /codon_start=1
 /product="pVI"
 /protein_id="AP_000210.1"
 /db_xref="GI:56160543"
 /translation="MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGI
 KNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQNK
 INSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLP
 TTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTAVVVTRPSRASLRRAASGP
 RSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF"
ORIGIN 
 1 atggaagaca tcaactttgc gtctctggcc ccgcgacacg gctcgcgccc gttcatggga
 61 aactggcaag atatcggcac cagcaatatg agcggtggcg ccttcagctg gggctcgctg
  121 tggagcggca ttaaaaattt cggttccacc gttaagaact atggcagcaa ggcctggaac
 181 agcagcacag gccagatgct gagggataag ttgaaagagc aaaatttcca acaaaaggtg
 241 gtagatggcc tggcctctgg cattagcggg gtggtggacc tggccaacca ggcagtgcaa
 301 aataagatta acagtaagct tgatccccgc cctcccgtag aggagcctcc accggccgtg
 361 gagacagtgt ctccagaggg gcgtggcgaa aagcgtccgc gccccgacag ggaagaaact
 421 ctggtgacgc aaatagacga gcctccctcg tacgaggagg cactaaagca aggcctgccc
 481 accacccgtc ccatcgcgcc catggctacc ggagtgctgg gccagcacac acccgtaacg
 541 ctggacctgc ctccccccgc cgacacccag cagaaacctg tgctgccagg cccgaccgcc
 601 gttgttgtaa cccgtcctag ccgcgcgtcc ctgcgccgcg ccgccagcgg tccgcgatcg
 661 ttgcggcccg tagccagtgg caactggcaa agcacactga acagcatcgt gggtctgggg
 721 gtgcaatccc tgaagcgccg acgatgcttc tga
//