LOCUS AC_000008 597 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus 5.
ACCESSION AC_000008 REGION: 15878..16474
VERSION AC_000008.1 GI:56160529
KEYWORDS .
SOURCE Human adenovirus 5
 ORGANISM Human adenovirus 5
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus C.
REFERENCE 1 (bases 1 to 597)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 597)
 AUTHORS Chroboczek,J., Bieber,F. and Jacrot,B.
 TITLE The sequence of the genome of adenovirus type 5 and its comparison
 with the genome of adenovirus type 2
 JOURNAL Virology 186 (1), 280-285 (1992)
 PUBMED 1727603
REFERENCE 3 (bases 1 to 597)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000408.
 On Oct 3, 2005 this sequence version replaced gi:33694637.
 This record represents an alternative annotation for M73260 M29978.
  It is included in the NCBI RefSeq collection as an alternative to
 the reference sequence NC_001405.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35938  M73260.1 1-35935
FEATURES Location/Qualifiers
 source 1..597
 /organism="Human adenovirus 5"
 /mol_type="genomic DNA"
 /serotype="Human adenovirus type 5"
 /db_xref="taxon:28285"
 /note="Human adenovirus C"
 CDS 1..597
 /codon_start=1
  /product="pVII"
 /protein_id="AP_000207.1"
 /db_xref="GI:56160540"
 /translation="MSILISPSNNTGWGLRFPSKMFGGAKKRSDQHPVRVRGHYRAPW
 GAHKRGRTGRTTVDDAIDAVVEEARNYTPTPPPVSTVDAAIQTVVRGARRYAKMKRRR
 RRVARRHRRRPGTAAQRAAAALLNRARRTGRRAAMRAARRLAAGIVTVPPRSRRRAAA
 AAAAAISAMTQGRRGNVYWVRDSVSGLRVPVRTRPPRN"
ORIGIN 
 1 atgtccatcc ttatatcgcc cagcaataac acaggctggg gcctgcgctt cccaagcaag
 61 atgtttggcg gggccaagaa gcgctccgac caacacccag tgcgcgtgcg cgggcactac
 121 cgcgcgccct ggggcgcgca caaacgcggc cgcactgggc gcaccaccgt cgatgacgcc
 181 atcgacgcgg tggtggagga ggcgcgcaac tacacgccca cgccgccacc agtgtccaca
 241 gtggacgcgg ccattcagac cgtggtgcgc ggagcccggc gctatgctaa aatgaagaga
 301 cggcggaggc gcgtagcacg tcgccaccgc cgccgacccg gcactgccgc ccaacgcgcg
 361 gcggcggccc tgcttaaccg cgcacgtcgc accggccgac gggcggccat gcgggccgct
 421 cgaaggctgg ccgcgggtat tgtcactgtg ccccccaggt ccaggcgacg agcggccgcc
 481 gcagcagccg cggccattag tgctatgact cagggtcgca ggggcaacgt gtattgggtg
 541 cgcgactcgg ttagcggcct gcgcgtgccc gtgcgcaccc gccccccgcg caactag
//