LOCUS       AC_000006               1125 bp    DNA     linear   VRL 15-MAY-2008
DEFINITION  Human adenovirus D, complete genome.
ACCESSION   AC_000006 REGION: 10622..11746
VERSION     AC_000006.1  GI:56160472
KEYWORDS    .
SOURCE      Human adenovirus D
  ORGANISM  Human adenovirus D
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 1125)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 1125)
  AUTHORS   Chillon,M., Bosch,A., Zabner,J., Law,L., Armentano,D., Welsh,M.J.
            and Davidson,B.L.
  TITLE     Group D adenoviruses infect primary central nervous system cells
            more efficiently than those from group C
  JOURNAL   J. Virol. 73 (3), 2537-2540 (1999)
   PUBMED   9971839
REFERENCE   3  (bases 1 to 1125)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK000406.
            On Oct 3, 2005 this sequence version replaced gi:33694580.
            This record represents an alternative annotation for AF108105 /
            NC_002067.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-35100             AF108105.1         1-35100
FEATURES             Location/Qualifiers
     source          1..1125
                     /organism="Human adenovirus D"
                     /mol_type="genomic DNA"
                     /serotype="Human adenovirus type 17"
                     /db_xref="taxon:130310"
                     /note="Human adenovirus D"
     CDS             1..1125
                     /codon_start=1
                     /product="52K"
                     /protein_id="AP_000145.1"
                     /db_xref="GI:56160476"
                     /translation="MHPVLRQMRPTPPATTATAAVAGAGASQPQPQTEMDLEEGEGLA
                     RLGAPSPERHPRVQLQKDVRPAYVPAQNLFRDRSGEEPEEMRDCRFRAGRELREGLDR
                     QRVLRDEDFEPNEQTGISPARAHVAAANLVTAYEQTVKQERNFQKSFNNHVRTLIARE
                     EVALGLMHLWDLAEAIVQNPDSKPLTAQLFLVVQHSRDNEAFREALLNIAEPEGRWLL
                     ELINILQSIVVQERSLSLAEKVAAINYSVLSLGKFYARKIYKTPYVPIDKEVKIDSFY
                     MRMALKVLTLSDDLGVYRNDRIHKAVSASRRRELSDRELMLSLRRALVGGAAGGEESY
                     FDMGADLHWQPSRRALEAAYGPEDLDEEEEEEEDAPAAGY"
ORIGIN      
        1 atgcatcccg tcctgcgcca aatgcgtccc acccccccgg cgaccaccgc gaccgcggcc
       61 gtagcaggcg ccggcgctag ccagccacag ccacagacag agatggactt ggaagagggc
      121 gaagggctgg cgagactggg ggcgccttcc ccggagcgac acccccgcgt gcagctgcag
      181 aaggacgtgc gcccggcgta cgtgcctgcg caaaacctgt tcagggaccg cagcggggag
      241 gagcccgagg agatgcgcga ctgccggttt cgggcgggca gggagctgcg cgagggcctg
      301 gaccgccagc gcgtgctgcg cgacgaggat ttcgagccga acgagcagac ggggatcagc
      361 cccgcgcgcg cgcacgtggc ggcggccaac ctggtgacgg cctacgagca gacggtgaag
      421 caggagcgca acttccaaaa gagtttcaac aaccatgtgc gcaccctgat cgcgcgcgag
      481 gaggtggccc tgggcctgat gcacctgtgg gacctggcgg aggccatcgt gcagaacccg
      541 gacagcaagc ctctgacggc gcagctgttc ctggtggtac agcacagcag ggacaacgag
      601 gcgttcaggg aggcgctgct aaacatcgcc gagcccgagg gtcgctggct gctggagctg
      661 atcaacatct tgcagagcat cgtagttcag gagcgcagcc tgagcttggc cgagaaggtg
      721 gcggcaatca actactcggt gcttagcctg ggcaagtttt acgcgcgcaa gatttacaag
      781 acgccgtacg tgcccataga caaggaggtg aagatagaca gcttttacat gcgcatggcg
      841 ctcaaggtgc tgacgctgag cgacgacctg ggcgtgtacc gcaacgaccg catccacaag
      901 gccgtgagcg cgagccggcg gcgcgagctg agcgaccgcg agctgatgct gagcctgcgc
      961 cgggcgctgg tagggggcgc cgccggcggc gaggagtcyt acttcgacat gggggcggac
     1021 ctgcattggc agccgagccg gcgcgccttg gaggccgcct acggtccaga ggacttggat
     1081 gaggaagagg aagaggagga ggatgcaccc gctgcggggt actga
//