LOCUS AC_000006 549 bp DNA linear VRL 15-MAY-2008
DEFINITION Human adenovirus D, complete genome.
ACCESSION AC_000006 REGION: 1569..2117
VERSION AC_000006.1 GI:56160472
KEYWORDS .
SOURCE Human adenovirus D
 ORGANISM Human adenovirus D
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 549)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 549)
 AUTHORS Chillon,M., Bosch,A., Zabner,J., Law,L., Armentano,D., Welsh,M.J.
 and Davidson,B.L.
 TITLE Group D adenoviruses infect primary central nervous system cells
 more efficiently than those from group C
 JOURNAL J. Virol. 73 (3), 2537-2540 (1999)
 PUBMED 9971839
REFERENCE 3 (bases 1 to 549)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000406.
 On Oct 3, 2005 this sequence version replaced gi:33694580.
 This record represents an alternative annotation for AF108105 /
 NC_002067.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35100 AF108105.1 1-35100
FEATURES Location/Qualifiers
 source 1..549
 /organism="Human adenovirus D"
 /mol_type="genomic DNA"
 /serotype="Human adenovirus type 17"
 /db_xref="taxon:130310"
 /note="Human adenovirus D"
 CDS 1..549
 /codon_start=1
 /product="E1B 19K"
  /protein_id="AP_000142.1"
 /db_xref="GI:56160473"
 /translation="MDVWTILADFSKTRRLVEDSSDGCSGFWRHWFGTPLSRLVYTVK
  KDYNEEFENLFADCSGLLDSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDK
 WSQNTQLSRGYILDFAAMHLWRAWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEE
 MRQAMDENPRSGLDPPSEEELD"
 misc_feature 306..>549
 /note="nonfunctional E1b 55K protein due to frameshift"
ORIGIN 
 1 atggatgtgt ggactatcct tgcagacttt agcaagacac gccggcttgt agaggatagt
 61 tcagacgggt gctccgggtt ctggagacac tggtttggaa ctcctctatc tcgcctggtg
 121 tacacagtta aaaaggatta taacgaggaa tttgaaaatc tttttgctga ttgctctggc
 181 ctgctagatt ctctgaatct cggccaccag tcccttttcc aggaaagggt actccacagc
 241 cttgattttt ccagcccagg gcgcactaca gccggggttg cttttgtggt ttttctggtt
 301 gacaaatgga gccagaacac ccaactgagc aggggctaca ttctggactt cgcagccatg
 361 cacctgtgga gggcatgggt caggcagcgg ggacagagaa tcttgaacta ctggcttcta
 421 cagccagcag ctccgggtct tcttcgtcta cacagacaaa catccatgtt ggaggaagaa
 481 atgaggcagg ccatggacga gaacccgagg agcggtctgg accctccgtc ggaagaggag
 541 ttggattga
//