LOCUS       AC_000006                705 bp    DNA     linear   VRL 15-MAY-2008
DEFINITION  Human adenovirus D, complete genome.
ACCESSION   AC_000006 REGION: 17009..17713
VERSION     AC_000006.1  GI:56160472
KEYWORDS    .
SOURCE      Human adenovirus D
  ORGANISM  Human adenovirus D
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 705)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 705)
  AUTHORS   Chillon,M., Bosch,A., Zabner,J., Law,L., Armentano,D., Welsh,M.J.
            and Davidson,B.L.
  TITLE     Group D adenoviruses infect primary central nervous system cells
            more efficiently than those from group C
  JOURNAL   J. Virol. 73 (3), 2537-2540 (1999)
   PUBMED   9971839
REFERENCE   3  (bases 1 to 705)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK000406.
            On Oct 3, 2005 this sequence version replaced gi:33694580.
            This record represents an alternative annotation for AF108105 /
            NC_002067.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-35100             AF108105.1         1-35100
FEATURES             Location/Qualifiers
     source          1..705
                     /organism="Human adenovirus D"
                     /mol_type="genomic DNA"
                     /serotype="Human adenovirus type 17"
                     /db_xref="taxon:130310"
                     /note="Human adenovirus D"
     CDS             1..705
                     /codon_start=1
                     /product="pVI"
                     /protein_id="AP_000149.1"
                     /db_xref="GI:56160480"
                     /translation="MEDINFASLAPRHGTRPFMGTWNEIGTSQLNGGAFNWSSVWSGL
                     KNFGSTLRTYGNKAWNSSTGQLLREKLKDQNFQQKVVDGLASGINGVVDIANQAVQRE
                     INSRLDPRPPTVVEMEDATLPPPKGEKRPRPDAEETILQVDEPPSYEEAVKAGMPTTR
                     IIAPLATGVMKPATLDLPPPPTPAPPKAAPVVQPPPVATAVRRVPARRQAQNWQSTLH
                     SIVGLGVKSLKRRRCY"
ORIGIN      
        1 atggaagaca tcaattttgc gtccctggct ccgcggcacg gcacgcggcc gttcatgggc
       61 acctggaacg agatcggcac cagccagctg aacgggggcg ccttcaattg gagcagtgtc
      121 tggagcgggc ttaaaaattt cggctcgacg ctccggacct atgggaacaa ggcctggaat
      181 agtagcacgg ggcagttgtt gagggaaaag ctcaaagacc agaacttcca gcagaaggtg
      241 gtggacggcc tggcctcggg cattaacggg gtggtggaca tcgcgaacca ggcagtgcag
      301 cgcgagataa acagccgtct ggacccgcgg ccgcccacgg tggtggagat ggaagatgca
      361 actcttccgc cgccgaaggg cgagaagcgg ccgcggccag atgcggagga gacgatcctg
      421 caggtggacg agccgccttc gtacgaggag gccgtgaagg ccggcatgcc caccacgcgc
      481 atcatcgcgc cactggccac gggtgtaatg aaacccgcca cccttgacct gcctccacca
      541 cccacgcccg ctccaccgaa ggcagctccg gttgtgcagc cccctccggt ggcgaccgcc
      601 gtgcgccgcg tccccgcccg ccgccaggcc cagaactggc agagcacgct gcacagtatt
      661 gtgggcctgg gagtgaaaag tctgaagcgc cgccgatgct attga
//