LOCUS AC_000006 705 bp DNA linear VRL 15-MAY-2008
DEFINITION Human adenovirus D, complete genome.
ACCESSION AC_000006 REGION: 17009..17713
VERSION AC_000006.1 GI:56160472
KEYWORDS .
SOURCE Human adenovirus D
ORGANISM Human adenovirus D
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 705)
AUTHORS Davison,A.J., Benko,M. and Harrach,B.
TITLE Genetic content and evolution of adenoviruses
JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
PUBMED 14573794
REFERENCE 2 (bases 1 to 705)
AUTHORS Chillon,M., Bosch,A., Zabner,J., Law,L., Armentano,D., Welsh,M.J.
and Davidson,B.L.
TITLE Group D adenoviruses infect primary central nervous system cells
more efficiently than those from group C
JOURNAL J. Virol. 73 (3), 2537-2540 (1999)
PUBMED 9971839
REFERENCE 3 (bases 1 to 705)
AUTHORS Davison,A.J.
TITLE Direct Submission
JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
analysis and is not yet supported by experimental evidence. The
reference sequence was derived from BK000406.
On Oct 3, 2005 this sequence version replaced gi:33694580.
This record represents an alternative annotation for AF108105 /
NC_002067.
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-35100 AF108105.1 1-35100
FEATURES Location/Qualifiers
source 1..705
/organism="Human adenovirus D"
/mol_type="genomic DNA"
/serotype="Human adenovirus type 17"
/db_xref="taxon:130310"
/note="Human adenovirus D"
CDS 1..705
/codon_start=1
/product="pVI"
/protein_id="AP_000149.1"
/db_xref="GI:56160480"
/translation="MEDINFASLAPRHGTRPFMGTWNEIGTSQLNGGAFNWSSVWSGL
KNFGSTLRTYGNKAWNSSTGQLLREKLKDQNFQQKVVDGLASGINGVVDIANQAVQRE
INSRLDPRPPTVVEMEDATLPPPKGEKRPRPDAEETILQVDEPPSYEEAVKAGMPTTR
IIAPLATGVMKPATLDLPPPPTPAPPKAAPVVQPPPVATAVRRVPARRQAQNWQSTLH
SIVGLGVKSLKRRRCY"
ORIGIN
1 atggaagaca tcaattttgc gtccctggct ccgcggcacg gcacgcggcc gttcatgggc
61 acctggaacg agatcggcac cagccagctg aacgggggcg ccttcaattg gagcagtgtc
121 tggagcgggc ttaaaaattt cggctcgacg ctccggacct atgggaacaa ggcctggaat
181 agtagcacgg ggcagttgtt gagggaaaag ctcaaagacc agaacttcca gcagaaggtg
241 gtggacggcc tggcctcggg cattaacggg gtggtggaca tcgcgaacca ggcagtgcag
301 cgcgagataa acagccgtct ggacccgcgg ccgcccacgg tggtggagat ggaagatgca
361 actcttccgc cgccgaaggg cgagaagcgg ccgcggccag atgcggagga gacgatcctg
421 caggtggacg agccgccttc gtacgaggag gccgtgaagg ccggcatgcc caccacgcgc
481 atcatcgcgc cactggccac gggtgtaatg aaacccgcca cccttgacct gcctccacca
541 cccacgcccg ctccaccgaa ggcagctccg gttgtgcagc cccctccggt ggcgaccgcc
601 gtgcgccgcg tccccgcccg ccgccaggcc cagaactggc agagcacgct gcacagtatt
661 gtgggcctgg gagtgaaaag tctgaagcgc cgccgatgct attga
//