LOCUS AY875648 630 bp DNA linear VRL 22-FEB-2006
DEFINITION Human adenovirus type 46, complete genome.
ACCESSION AY875648 REGION: 20603..21232
VERSION AY875648.1 GI:62177315
KEYWORDS .
SOURCE Human adenovirus 46
 ORGANISM Human adenovirus 46
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus D.
REFERENCE 1 (bases 1 to 630)
 AUTHORS Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
 Bristol,A.
 TITLE Complete sequence and organization of the human adenovirus serotype
 46 genome
 JOURNAL Virus Res. 116 (1-2), 119-128 (2006)
 PUBMED 16242804
REFERENCE 2 (bases 1 to 630)
 AUTHORS Police,S.R.
 TITLE Direct Submission
 JOURNAL Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
 Blvd, South San Francisco, CA 94080, USA
FEATURES Location/Qualifiers
 source 1..630
 /organism="Human adenovirus 46"
 /mol_type="genomic DNA"
 /db_xref="taxon:46941"
  /note="Ad46
 subgroup: D"
 CDS 1..630
 /codon_start=1
 /product="protease"
 /protein_id="AAX70960.1"
 /db_xref="GI:62177343"
 /translation="MSGSSERELAAIVRDLGCGPYFLGTHDKRFPGFLAGDKLACAIV
 NTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALASSP
  DRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQ
 SPQVLPTLRRNQEELYRFLARHSPYFRSHRAAIEHATAFDKMKQLRVSQ"
ORIGIN 
 1 atgagcggct ccagcgaacg agagctcgcg gccatcgtgc gcgacctggg ctgcgggccc
 61 tactttttgg gcacccacga caagcgcttc ccgggcttcc tcgccggcga caagctggcc
 121 tgcgccatcg tcaacacggc cggccgcgag accggaggcg tgcactggct cgccttcggc
 181 tggaacccgc gctcgcgcac ctgctacatg ttcgacccct ttgggttctc ggaccgccgg
 241 ctcaagcaga tttacagctt cgagtacgag gccatgctgc gccgcagcgc gcttgcctcc
 301 tcgcccgacc gctgtctcag cctcgagcag tccacccaga ccgtgcaggg gcccgactcc
 361 gccgcctgcg gacttttctg ttgcatgttc ttgcatgcct tcgtgcactg gcccgaccga
 421 cccatggacg gaaaccccac catgaacttg ctgacggggg tgcccaacgg catgctacaa
 481 tcgccacagg tgctgcccac cctcaggcgc aaccaggagg agctctaccg cttcctcgcg
 541 cgccactccc cttactttcg ctcccaccgc gccgccatcg aacacgccac cgcttttgac
 601 aaaatgaaac aactgcgtgt atctcaataa
//