LOCUS AY875648 1119 bp DNA linear VRL 22-FEB-2006
DEFINITION Human adenovirus type 46, complete genome.
ACCESSION AY875648 REGION: 10628..11746
VERSION AY875648.1 GI:62177315
KEYWORDS .
SOURCE Human adenovirus 46
 ORGANISM Human adenovirus 46
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus D.
REFERENCE 1 (bases 1 to 1119)
 AUTHORS Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
 Bristol,A.
 TITLE Complete sequence and organization of the human adenovirus serotype
 46 genome
 JOURNAL Virus Res. 116 (1-2), 119-128 (2006)
 PUBMED 16242804
REFERENCE 2 (bases 1 to 1119)
 AUTHORS Police,S.R.
 TITLE Direct Submission
 JOURNAL Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
 Blvd, South San Francisco, CA 94080, USA
FEATURES Location/Qualifiers
 source 1..1119
 /organism="Human adenovirus 46"
 /mol_type="genomic DNA"
 /db_xref="taxon:46941"
 /note="Ad46
 subgroup: D"
 CDS 1..1119
 /codon_start=1
 /product="52/55 kDa"
 /protein_id="AAX70952.1"
 /db_xref="GI:62177335"
 /translation="MHPVLRQMRPTPPATTATAAVAGAGASQPQTEMDLEEGEGLARL
 GAPSPERHPRVQLQKDVRPAYVPAQNLFRDRSGEEPEEMRDCRFRAGRELREGLDRQR
  VLRDEDFEPNEQTGISPARAHVAAANLVTAYEQTVKQERNFQKSFNNHVRTLIAREEV
 ALGLMHLWDLAEAIVQNPDSKPLTAQLFLVVQHSRDNEAFREALLNIAEPEGRWLLEL
 INILQSIVVQERSLSLAEKVAAINYSVLSLGKFYARKIYKTPYVPIDKEVKIDSFYMR
  MALKVLTLSDDLGVYRNDRIHKAVSTSRRRELSDRELMLSLRRALVGGAAGGEESYFD
 MGADLHWQPSRRALEAAYGPEDLDEEEEEEEDAPVAGY"
ORIGIN 
 1 atgcatcccg tcctgcgcca aatgcgtccc acccccccgg cgaccaccgc gaccgcggcc
 61 gtagcaggcg ccggcgctag ccagccacag acagagatgg acttggaaga gggcgaaggg
 121 ctggcgagac tgggggcgcc gtccccggag cgacaccccc gcgtgcagct gcagaaggac
 181 gtgcgcccgg cgtacgtgcc tgcgcagaac ctgttcaggg accgcagcgg ggaggagccc
 241 gaggagatgc gcgactgccg ttttcgggcg ggcagggagc tgcgcgaggg cctggaccgc
 301 cagcgcgtgc tgcgcgacga ggatttcgag ccgaacgagc agacggggat cagccccgcg
 361 cgcgcgcacg tggcggcggc caacctggtg acggcctacg agcagacggt gaagcaggag
 421 cgcaactttc aaaagagttt caacaaccac gtgcgcaccc tgatcgcgcg cgaggaggtg
 481 gccctgggcc tgatgcacct gtgggacctg gcggaggcca tcgtgcagaa cccggacagc
 541 aagcctctga cggcgcagct gttcctggtg gtgcagcaca gcagggacaa cgaggcgttc
 601 agggaggcgc tgctgaacat cgccgagccc gagggtcgct ggctgctgga gctgatcaac
 661 attttgcaga gcatcgtagt gcaggagcgc agcttgagcc tggccgagaa ggtggcggcg
 721 atcaattact cggtgctgag cctgggcaag ttttacgcgc gcaagattta caagacgccg
 781 tacgtgccca tagacaagga ggtgaagata gacagctttt acatgcgcat ggcgctcaag
 841 gtgctgacgc tgagcgacga cctgggcgtg taccgcaacg accgcatcca caaggccgtg
 901 agcacgagcc gacggcgcga gctgagcgac cgcgagctaa tgctaagcct gcgccgggcg
 961 ctggtagggg gcgccgccgg tggcgaggag tcctacttcg acatgggggc ggacctgcat
 1021 tggcagccga gccggcgcgc cttggaggcc gcctacggtc cagaggactt ggatgaggaa
 1081 gaggaagagg aggaggatgc acccgttgcg gggtactga
//