LOCUS AY875648 405 bp DNA linear VRL 22-FEB-2006
DEFINITION Human adenovirus type 46, complete genome.
ACCESSION AY875648 REGION: 3447..3851
VERSION AY875648.1 GI:62177315
KEYWORDS .
SOURCE Human adenovirus 46
 ORGANISM Human adenovirus 46
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus D.
REFERENCE 1 (bases 1 to 405)
 AUTHORS Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
 Bristol,A.
 TITLE Complete sequence and organization of the human adenovirus serotype
 46 genome
 JOURNAL Virus Res. 116 (1-2), 119-128 (2006)
 PUBMED 16242804
REFERENCE 2 (bases 1 to 405)
 AUTHORS Police,S.R.
 TITLE Direct Submission
 JOURNAL Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
 Blvd, South San Francisco, CA 94080, USA
FEATURES Location/Qualifiers
 source 1..405
 /organism="Human adenovirus 46"
 /mol_type="genomic DNA"
 /db_xref="taxon:46941"
 /note="Ad46
 subgroup: D"
 CDS 1..405
 /codon_start=1
 /product="pIX"
 /protein_id="AAX70951.1"
 /db_xref="GI:62177334"
 /translation="MNGTGGAFEGGLFSPYLTTRLPGWAGVRQNVMGSTVDGRPVLPA
 NSSTMTYATVGNSSLDSTAAAAAAAAAMTATRLASSYMPSSSSSPSVPSSIIAEEKLL
 ALLAELEALSRQLAALTQQVSDLREQQQQQNK"
ORIGIN 
  1 atgaacggga ccggcggggc cttcgaaggg gggcttttta gcccttattt gacaacccgc
 61 ctgccgggat gggccggagt tcgtcagaat gtgatgggat cgacggtgga tgggcgccca
 121 gtgcttccag caaattcctc gaccatgacc tacgcgaccg tggggaactc gtcgctcgac
 181 agcaccgccg cagccgcggc agccgcagcc gccatgacag cgacgagact ggcctcgagc
 241 tacatgccca gcagcagcag tagcccctct gtgcccagtt ccatcatcgc cgaggagaaa
 301 ctgctggccc tgttggccga gctggaagcc ctgagccgcc agctggccgc cctgacccag
 361 caggtgtccg atctccgcga gcaacagcag cagcaaaata aatga
//