LOCUS AY875648 705 bp DNA linear VRL 22-FEB-2006
DEFINITION Human adenovirus type 46, complete genome.
ACCESSION AY875648 REGION: 17012..17716
VERSION AY875648.1 GI:62177315
KEYWORDS .
SOURCE Human adenovirus 46
 ORGANISM Human adenovirus 46
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 Human adenovirus D.
REFERENCE 1 (bases 1 to 705)
 AUTHORS Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
 Bristol,A.
 TITLE Complete sequence and organization of the human adenovirus serotype
 46 genome
 JOURNAL Virus Res. 116 (1-2), 119-128 (2006)
 PUBMED 16242804
REFERENCE 2 (bases 1 to 705)
 AUTHORS Police,S.R.
 TITLE Direct Submission
 JOURNAL Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
 Blvd, South San Francisco, CA 94080, USA
FEATURES Location/Qualifiers
 source 1..705
 /organism="Human adenovirus 46"
 /mol_type="genomic DNA"
 /db_xref="taxon:46941"
 /note="Ad46
 subgroup: D"
 CDS 1..705
 /codon_start=1
 /product="pVI"
 /protein_id="AAX70958.1"
 /db_xref="GI:62177341"
 /translation="MEDINFASLAPRHGTRPFMGTWNEIGTSQLNGGAFNWSSVWSGL
 KNFGSTLRTYGNKAWNSSTGQLLREKLKDQNFQQKVVDGLASGINGVVDIANQAVQRE
  INSRLDPRPPTVVEMEDATLPPPKGEKRPRPDAEETILQVDEPPSYEEAVKAGMPTTR
 IIAPLATGVMKPATLDLPPPPTPAPPKAAPVVQAPPVATAVRRVPARRQAQNWQSTLH
 SIVGLGVKSLKRRRCY"
ORIGIN 
 1 atggaagaca tcaattttgc gtccctggct ccgcggcacg gcacgcggcc gttcatgggc
 61 acctggaacg agatcggcac cagccagctg aacgggggcg ccttcaattg gagcagtgtc
 121 tggagcgggc ttaaaaattt cggctcgacg ctccggacct atgggaacaa ggcctggaat
 181 agtagcacgg ggcagttgtt aagggaaaag ctcaaagacc agaacttcca gcagaaggtg
 241 gtggacgggc tggcctcggg cattaacggg gtggtggaca tcgcgaacca ggccgtgcag
 301 cgcgagataa acagccggct ggacccgcgg ccgcccacgg tggtggagat ggaagatgca
 361 actcttccgc cgcccaaagg cgagaagcgg ccgcggcccg acgcggagga gacgatcctg
 421 caggtggacg agccgccctc gtacgaggag gccgtcaagg ccggcatgcc caccacgcgc
 481 atcatcgcgc cgctggccac gggtgtaatg aaacccgcca cccttgacct gcctccacca
 541 cccacgcccg ctccaccgaa ggcagctccg gtcgtgcagg cccccccggt ggcgaccgcc
 601 gtgcgccgcg tccccgcccg ccgccaggcc cagaactggc agagcacgct gcacagtatc
 661 gtgggcctgg gagtgaaaag tctgaagcgc cgccgatgct attga
//