LOCUS       AY875648                 588 bp    DNA     linear   VRL 22-FEB-2006
DEFINITION  Human adenovirus type 46, complete genome.
ACCESSION   AY875648 REGION: 15078..15665
VERSION     AY875648.1  GI:62177315
KEYWORDS    .
SOURCE      Human adenovirus 46
  ORGANISM  Human adenovirus 46
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            Human adenovirus D.
REFERENCE   1  (bases 1 to 588)
  AUTHORS   Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
            Bristol,A.
  TITLE     Complete sequence and organization of the human adenovirus serotype
            46 genome
  JOURNAL   Virus Res. 116 (1-2), 119-128 (2006)
   PUBMED   16242804
REFERENCE   2  (bases 1 to 588)
  AUTHORS   Police,S.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
            Blvd, South San Francisco, CA 94080, USA
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Human adenovirus 46"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46941"
                     /note="Ad46
                     subgroup: D"
     CDS             1..588
                     /codon_start=1
                     /product="pVII"
                     /protein_id="AAX70955.1"
                     /db_xref="GI:62177338"
                     /translation="MSILISPSNNTGWGLTRPSTMYGGAKKRSQQHPVRVRGHFRAPW
                     GAYKRGRTSTAAVRTTVDDVIDSVVADARNYTPAPSTVDAVIDSVVADARDYARRKSR
                     RRRIARRHRSTPAMRAARALLRRARRTGRRAMMRAARRAATAPTPAGRTRRRAAAAAA
                     AAISSMTRPRRGNVYWVRDSVTGVRVPVRTRPPRP"
ORIGIN      
        1 atgtctattc tcatctcgcc cagcaataac accggctggg gtcttactag gcccagcacc
       61 atgtacggag gagccaagaa gcgctcccag cagcaccccg tccgcgtccg cggccacttc
      121 cgcgctccct ggggcgctta caagcgcggg cggacttcca ccgccgccgt gcgcaccacc
      181 gtcgacgacg tcatcgactc ggtggtcgcc gacgcgcgca actacacccc cgccccctcc
      241 accgtggacg cggtcatcga cagcgtggtg gccgacgcgc gcgactatgc cagacgcaag
      301 agccggcggc gacggatcgc caggcgccac cggagcacgc ccgccatgcg agccgcccgg
      361 gctctactgc gccgcgccag acgcacgggc cgccgggcca tgatgcgagc cgcgcgccgc
      421 gctgccactg cacccacccc cgcaggcagg actcgcagac gagcggccgc cgccgccgcc
      481 gcggccattt ctagcatgac cagacccagg cgcggaaacg tgtactgggt gcgcgactcc
      541 gttacgggcg tgcgcgtgcc cgtgcgcacc cgtcctcctc gtccctga
//