LOCUS       AY875648                 684 bp    DNA     linear   VRL 22-FEB-2006
DEFINITION  Human adenovirus type 46, complete genome.
ACCESSION   AY875648 REGION: 25479..26162
VERSION     AY875648.1  GI:62177315
KEYWORDS    .
SOURCE      Human adenovirus 46
  ORGANISM  Human adenovirus 46
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            Human adenovirus D.
REFERENCE   1  (bases 1 to 684)
  AUTHORS   Reddy,P.S., Ganesh,S., Knowles,N.J., Kaleko,M., Connelly,S. and
            Bristol,A.
  TITLE     Complete sequence and organization of the human adenovirus serotype
            46 genome
  JOURNAL   Virus Res. 116 (1-2), 119-128 (2006)
   PUBMED   16242804
REFERENCE   2  (bases 1 to 684)
  AUTHORS   Police,S.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-DEC-2004) Virotherapy, Cell Genesys Inc., 500 Forbes
            Blvd, South San Francisco, CA 94080, USA
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Human adenovirus 46"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46941"
                     /note="Ad46
                     subgroup: D"
     CDS             1..684
                     /codon_start=1
                     /product="pVIII"
                     /protein_id="AAX70962.1"
                     /db_xref="GI:62177345"
                     /translation="MSKEIPTPYMWSYQPQMGLAAGASQDYSTRMNWLSAGPSMISRV
                     NGVRNHRNQILLEQAAVTSTPRAKLNPRNWPSTLVYQEIPGPTTVLLPRDALAEVRMT
                     NSGVQLAGGASRCPLRPQSGIKTLVIRGRGTQLNDELVSSSIGLRPDGVFQLAGAGRS
                     SFTPNQAYLTLQSSSSEPRSGGIGTLQFVEEFVPSVYFNPFSGSPGLYPDEFIPNFDA
                     VREAVDGYD"
ORIGIN      
        1 atgagcaagg agattcccac cccttacatg tggagctatc agccccagat gggcctggcc
       61 gcgggcgcct cccaggacta ctccacccgc atgaactggc tcagtgccgg cccctcgatg
      121 atctcacggg tcaacggggt ccgtaaccat cgaaaccaga tattgttgga gcaggcggca
      181 gtcacctcca cgcccagggc aaagctcaac ccgcgtaatt ggccctccac cctggtgtat
      241 caggaaatcc ccgggccgac taccgtacta cttccgcgtg acgcactggc cgaagtccgc
      301 atgactaact caggtgtcca gctggccggc ggcgcttccc ggtgcccgct ccgcccacaa
      361 tcgggtataa aaaccctggt gatccgaggc agaggcacac agctcaacga cgagttggtg
      421 agctcttcga tcggtctgcg accggacgga gtgttccaac tagccggagc cgggagatcg
      481 tccttcactc ccaaccaggc ctacctgacc ttgcagagca gctcttcgga gcctcgctcc
      541 ggaggcatcg gaaccctcca gttcgtggag gagtttgtgc cctcggtcta cttcaacccc
      601 ttctcgggat cgccaggcct ctacccggac gagttcatac cgaacttcga cgcagtgaga
      661 gaagcggtgg acggctacga ctga
//