LOCUS AC_000011 621 bp DNA linear VRL 03-APR-2008
DEFINITION Simian adenovirus 25, complete genome.
ACCESSION AC_000011 REGION: 21137..21757
VERSION AC_000011.1 GI:56160634
KEYWORDS .
SOURCE Simian adenovirus 25
 ORGANISM Simian adenovirus 25
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 621)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 621)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000413.
 On Oct 3, 2005 this sequence version replaced gi:33694802.
 This record represents an alternative annotation for AR101859 and
 AF394196. It is included in the NCBI RefSeq collection as an
 alternative to the reference sequence NC_003266.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-36519 AR101859.1 1-36519
 4-36518 AF394196.1 4-36521
FEATURES Location/Qualifiers
 source 1..621
 /organism="Simian adenovirus 25"
 /mol_type="genomic DNA"
 /serotype="Simian adenovirus 25"
 /db_xref="taxon:175567"
 /note="Human adenovirus E"
 CDS 1..621
 /codon_start=1
 /product="protease"
  /protein_id="AP_000314.1"
 /db_xref="GI:56160650"
 /translation="MAAGSGEQELRAIIRDLGCGPYFLGTFDKRFPGFMAPHKLACAI
  VNTAGRETGGEHWLAFAWNPRSNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSALATE
 DRCVTLEKSTQTVQGPRSAACGLFCCMFLHAFVHWPDRPMDKNPTMNLLTGVPNGMLQ
 SPQVEPTLRRNQEALYRFLNSHSAYFRSHRARIEKATAFDRMNQDM"
ORIGIN 
 1 atggccgcgg gctccggcga gcaggagctc agggccatca tccgcgacct gggctgcggg
 61 ccctacttcc tgggcacctt cgataagcgc ttcccgggat tcatggcccc gcacaagctg
 121 gcctgcgcca tcgtcaacac ggccggccgc gagaccgggg gcgagcactg gctggccttc
 181 gcctggaacc cgcgctcgaa cacctgctac ctcttcgacc ccttcgggtt ctcggacgag
 241 cgcctcaagc agatctacca gttcgagtac gagggcctgc tgcgccgcag cgccctggcc
 301 accgaggacc gctgcgtcac cctggaaaag tccacccaga ccgtgcaggg tccgcgctcg
 361 gccgcctgcg ggctcttctg ctgcatgttc ctgcacgcct tcgtgcactg gcccgaccgc
 421 cccatggaca agaaccccac catgaacttg ctgacggggg tgcccaacgg catgctccag
 481 tcgccccagg tggaacccac cctgcgccgc aaccaggagg cgctctaccg cttcctcaac
 541 tcccactccg cctactttcg ctcccaccgc gcgcgcatcg agaaggccac cgccttcgac
 601 cgcatgaatc aagacatgta a
//