LOCUS AC_000011 774 bp DNA linear VRL 03-APR-2008
DEFINITION Simian adenovirus 25, complete genome.
ACCESSION AC_000011 REGION: join(577..1141,1235..1443)
VERSION AC_000011.1 GI:56160634
KEYWORDS .
SOURCE Simian adenovirus 25
 ORGANISM Simian adenovirus 25
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 774)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
 PUBMED 14573794
REFERENCE 2 (bases 1 to 774)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, U.K.
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK000413.
 On Oct 3, 2005 this sequence version replaced gi:33694802.
 This record represents an alternative annotation for AR101859 and
 AF394196. It is included in the NCBI RefSeq collection as an
 alternative to the reference sequence NC_003266.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-36519 AR101859.1 1-36519
 4-36518 AF394196.1 4-36521
FEATURES Location/Qualifiers
 source 1..774
 /organism="Simian adenovirus 25"
 /mol_type="genomic DNA"
 /serotype="Simian adenovirus 25"
 /db_xref="taxon:175567"
 /note="Human adenovirus E"
 CDS 1..774
 /codon_start=1
 /product="E1A"
  /protein_id="AP_000299.1"
 /db_xref="GI:56160635"
 /translation="MRHLRDLPDEKIIIASGNEILELVVNAMMGDDPPEPPTPFETPS
 LHDLYDLEVDVPEDDPNEEAVNDFFSDAALLAAEEASSSSSDSDSSLHTPRPGRGEKK
 IPELKGEEMDLRCYEECLPPSDDEDEQAIQNAASQGVQAASESFALDCPPLPGHGCKS
 CEFHRMNTGDKAVLCALCYMRAYNHCVYSPVSDADDETPTTKSTSSPPEIGTSPPENI
 VRPVPVRATGRRAAVECLDDLLQGGVEPLDLCTRKRPRH"
ORIGIN 
 1 atgaggcacc tgagagacct gcccgatgag aaaatcatca tcgcttccgg gaacgagatt
 61 ctggaactgg tggtaaatgc catgatgggc gacgaccctc cggagccccc caccccattt
 121 gagacacctt cgctgcacga tttgtatgat ctggaggtgg atgtgcccga ggacgatccc
 181 aatgaggagg cggtaaatga tttttttagc gatgccgcgc tgctagctgc cgaggaggct
 241 tcgagctcta gctcagacag cgactcttca ctgcataccc ctagacccgg cagaggtgag
 301 aaaaagatcc ccgagcttaa aggggaagag atggacttgc gctgctatga ggaatgcttg
  361 cccccgagcg atgatgagga cgagcaggcg atccagaacg cagcgagcca gggagtgcaa
 421 gccgccagcg agagctttgc gctggactgc ccgcctctgc ccggacacgg ctgtaagtct
 481 tgtgaatttc atcgcatgaa tactggagat aaagctgtgt tgtgtgcact ttgctatatg
 541 agagcttaca accattgtgt ttacagtccc gtctctgacg cagatgatga gacccccact
 601 acaaagtcca cttcgtcacc cccagaaatt ggcacatctc cacctgagaa tattgttaga
 661 ccagttcctg ttagagccac tgggaggaga gcagctgtgg aatgtttgga tgacttgcta
 721 cagggtgggg ttgaaccttt ggacttgtgt acccggaaac gccccaggca ctaa
//