LOCUS       AC_000011                234 bp    DNA     linear   VRL 03-APR-2008
DEFINITION  Simian adenovirus 25, complete genome.
ACCESSION   AC_000011 REGION: 17170..17403
VERSION     AC_000011.1  GI:56160634
KEYWORDS    .
SOURCE      Simian adenovirus 25
  ORGANISM  Simian adenovirus 25
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 234)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 234)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK000413.
            On Oct 3, 2005 this sequence version replaced gi:33694802.
            This record represents an alternative annotation for AR101859 and
            AF394196. It is included in the NCBI RefSeq collection as an
            alternative to the reference sequence NC_003266.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-36519             AR101859.1         1-36519
            4-36518             AF394196.1         4-36521
FEATURES             Location/Qualifiers
     source          1..234
                     /organism="Simian adenovirus 25"
                     /mol_type="genomic DNA"
                     /serotype="Simian adenovirus 25"
                     /db_xref="taxon:175567"
                     /note="Human adenovirus E"
     CDS             1..234
                     /codon_start=1
                     /product="pX"
                     /protein_id="AP_000311.1"
                     /db_xref="GI:56160647"
                     /translation="MALTCRLRVPITGYRGRKPRRRRLAGNGMRRHHHRRRRAISKRL
                     GGGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN      
        1 atggccctca catgccgcct tcgcgttccc attacgggct accgaggaag aaaaccgcgc
       61 cgtagaaggc tggcggggaa cgggatgcgt cgccaccacc accggcggcg gcgcgccatc
      121 agcaagcggt tggggggagg cttcctgccc gcgctgatcc ccatcatcgc cgcggcgatc
      181 ggggcgatcc ccggcattgc ttccgtggcg gtgcaggcct ctcagcgcca ctga
//