LOCUS L19443 2313 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 22545..24857
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
 ORGANISM Human adenovirus F
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 2313)
 AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
 Rozijn,T.H.
 TITLE Structure and organization of the left-terminal DNA regions of
 fastidious adenovirus types 40 and 41
 JOURNAL Gene 58 (1), 109-126 (1987)
 PUBMED 2961652
REFERENCE 2 (bases 1 to 2313)
 AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
 TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
 repeat: close relation to that of adenovirus type 5
 JOURNAL Virology 156 (2), 414-416 (1987)
 PUBMED 3811242
REFERENCE 3 (bases 1 to 2313)
 AUTHORS Ishino,M.
 TITLE Analysis of structure and function of human adenovirus type 40
  leftmost 1.85 kb region including transforming E1A gene
 JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 2313)
 AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
 Sussenbach,J.S.
 TITLE The genes encoding the DNA binding protein and the 23K protease of
 adenovirus types 40 and 41
 JOURNAL Virology 163 (1), 1-10 (1988)
 PUBMED 3279700
REFERENCE 5 (bases 1 to 2313)
 AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
 TITLE Characterization of adenovirus type 40 E1 region
 JOURNAL Virology 165 (1), 95-102 (1988)
 PUBMED 2968714
REFERENCE 6 (bases 1 to 2313)
 AUTHORS Kidd,A.H. and Erasmus,M.J.
 TITLE Sequence characterization of the adenovirus 40 fiber gene
 JOURNAL Virology 172 (1), 134-144 (1989)
 PUBMED 2773314
REFERENCE 7 (bases 1 to 2313)
 AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
 TITLE The adenovirus type 40 hexon: sequence, predicted structure and
 relationship to other adenovirus hexons
 JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
 PUBMED 2481711
REFERENCE 8 (bases 1 to 2313)
 AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
 TITLE The DNA sequence of adenovirus type 40
 JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
 PUBMED 8263936
REFERENCE 9 (bases 1 to 2313)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL Unpublished
REFERENCE 10 (bases 1 to 2313)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
FEATURES Location/Qualifiers
 source 1..2313
 /organism="Human adenovirus F"
 /mol_type="genomic DNA"
 /isolate="Dugan"
 /db_xref="taxon:130309"
 /tissue_lib="ATCC VR-931"
 mRNA complement(521..597)
 /product="pol"
 mRNA complement(521..597)
 /product="pTP"
 mRNA <1..>2313
 /product="100K"
 mRNA <2011..>2313
 /product="22K"
 mRNA 2011..>2313
 /product="33K"
 mRNA complement(521..597)
 /product="DBP"
 mRNA complement(join(521..597,1680..1744))
 /product="late DBP"
 CDS 1..2313
 /codon_start=1
 /product="100K"
 /protein_id="AAC13970.1"
 /db_xref="GI:303992"
 /translation="MEEDLKLQPDSETLTTPNSEVGAVELVKHEEENEQVEQDPGYVT
 PPEDGKEPVAALSEPNYLGGEDDVLLKHIARQSTIVREALKECTQTPLTVEELSRAYE
 ANLFSPRVPPKKQPNGTCETNPRLNFYPVFAVPEALATYHIFFKNQRIPLSCRANRTR
 GDGLLHLKAGAHIPEIVSLEEVPKIFEGLGKDEKRAANALQKNETENQNVLVELEGDN
 ARLAVLKRTIEVSHFAYPALNLPPKVMRSVMDQVLIKRAEPIDPQQPDLNSEDGQPVV
 SDDELARWLGTQDPSELQERRKMMMAAVLVTVELECLQRFFANPQTLRKVEESLHYAF
 RHGYVRQACKISNVELSNLISYMGILHENRLGQNVLHCTLQGEARRDYVRDCIYLFLI
 LTWQTAMGVWQQCLEEQNLQELNKLLVRARRELWTSFDERTVARQLANLIFPERLMQT
  LQNGLPDFVSQSILQNFRSFVLERSGILPAMSCALPSDFVPLCYRECPPPLWSHCYLL
 RLANYLAHHSDLMEDSSGDGLLECHCRCNLCTPHRSLVCNTELLSETQVIGTFEIQGP
 EQQEGASSLKLTPALWTSAYLRKFIPEDYHAHQIKFYEDQSRPPKVPLTACVITQSQI
 LAQLQAIQQARQEFLLKKGHGVYLDPQTGEELNTPSLSAAASCRSQKHATQGKQASHR
 ATAIPAETTKAVGRGGDVGRQPGRGSFRRGGGGADGELGQPRRGGPRGRGGRNHRQRQ
 GTIFQKTRSEPTSENYPAPATATMFTESQP"
 TATA_signal complement(1768..1773)
 /note="for late DBP"
 CDS 2015..>2313
 /codon_start=1
 /product="33K"
 /protein_id="AAC13956.1"
  /db_xref="GI:303978"
 /translation="MPPKGNKHPIAQRQSQQKLQKQWDEEETWDDSQAEEVSDEEAEE
 QMESWDSLDEEDLEDVEEETIASDKAPSFKKPVRSQPPKTIPPLPPQPCSLKASRRWD
 TVSIAGSPTAPAAPTKRLEKTPRVRKTSSAIATRQDSPATQELRKRIFPTLYAIFQQS
 RGQQLELKVKNRSLRSLTRSCLYHRSEDQLQRTLEDAEALFNKYCSVSLKD"
 CDS 2015..>2313
 /codon_start=1
 /product="22K"
 /protein_id="AAC13971.1"
 /db_xref="GI:303993"
 /translation="MPPKGNKHPIAQRQSQQKLQKQWDEEETWDDSQAEEVSDEEAEE
 QMESWDSLDEEDLEDVEEETIASDKAPSFKKPVRSQPPKTIPPLPPQPCSLKASRRWD
 TVSIAGSPTAPAGKQPKRARRGYCSWRAHKSNIVACLQHCRGNISFARRYLLFHDGVA
 VPRNVLYYYRHLYSPYETFGENTSSA"
ORIGIN 
 1 atggaggagg atcttaagct gcagccagac tccgaaacct taaccacccc caactctgag
 61 gtcggcgccg tcgagctagt gaaacatgag gaggaaaatg agcaagtgga gcaagatccg
 121 ggctatgtaa cgccccccga ggacggcaag gaaccagtgg ccgcactcag cgaacccaac
 181 tatttgggag gggaggacga cgtgctcctg aagcacatag cgcgacagag caccattgta
 241 cgagaagccc tcaaggaatg cacacagact ccgctgacgg tggaggaatt aagccgcgcg
 301 tatgaagcta acctgttttc gccgcgtgta ccgccaaaaa agcagcctaa cggcacctgc
 361 gaaacaaacc cgcgcctcaa tttttatccc gtctttgcgg tgcctgaagc actggctact
 421 tatcacatct ttttcaagaa ccaacgcatt cccctctctt gccgcgccaa ccgtacacgc
  481 ggtgacggcc ttttgcatct caaagctgga gctcacatac ctgagatcgt ttctttagaa
 541 gaagtaccca agatttttga aggtcttggc aaggacgaaa aacgggcggc aaatgctctg
 601 caaaaaaacg aaaccgagaa tcagaacgtg ttggtagagc tggagggtga caacgcgcgt
 661 ttggccgtac tcaaacgcac cattgaagtt tcacactttg cttatcccgc gctaaatctt
 721 cctcccaaag taatgcgttc tgttatggat caagtgctta ttaagcgagc agagcccatt
 781 gatccccaac aacccgacct aaactctgag gacggacaac ccgtagtctc agacgacgag
 841 cttgctcgct ggctaggtac ccaggatccc tcagagctgc aagagcggcg aaaaatgatg
 901 atggcagcag ttttggttac agtggaattg gaatgcctgc agcgcttctt tgctaaccct
 961 caaacactgc gcaaagtcga ggagtccctg cactatgcct tccgtcatgg ctacgttcgt
 1021 caggcctgca agatctccaa cgtagagctc agcaatctga tctcttacat gggcattcta
 1081 cacgaaaacc ggctggggca gaacgttctt cactgcacct tgcaagggga ggcccgccga
 1141 gactacgtcc gcgactgcat ctatcttttc cttattctca cctggcaaac cgctatggga
 1201 gtctggcagc agtgcttgga agagcaaaac ctccaggagc ttaataaatt gctagtacga
 1261 gcccgtcgcg aactctggac gtcttttgac gagcgtacgg ttgcccgcca gctggcaaac
 1321 ctcatttttc ccgagcggct tatgcaaaca ttgcaaaatg gtttgccaga ctttgtcagc
 1381 caaagtatct tgcaaaactt tcgctccttt gtactcgagc gttccggcat cttgccggct
 1441 atgagttgtg ctttgccctc cgattttgtc cccctctgct accgcgaatg ccccccaccg
 1501 ttgtggagtc actgctacct cctccgtcta gccaactatt tggcccacca ctctgatctt
 1561 atggaagact ctagcggcga cggactgcta gaatgtcact gccgttgcaa cctctgcacc
 1621 cctcatcgct cactggtctg taacaccgag cttcttagcg aaacccaagt aatcggtacc
 1681 tttgagattc aagggccaga gcaacaagaa ggtgcttcca gcctcaaact cacgccggcg
 1741 ttgtggactt ccgcctacct acgcaaattt attcccgaag actatcacgc ccaccaaatt
 1801 aaattttatg aagaccaatc acgacctccc aaagtccccc ttacagcctg tgttatcacc
 1861 caaagccaaa ttctggccca attacaagct attcagcagg cgcgtcagga atttctttta
 1921 aaaaaaggac acggggtcta tttggacccc caaaccggtg aagaacttaa taccccgtca
 1981 ctctccgccg ccgcttcgtg ccgttcgcag aaacatgcca cccaagggaa acaagcatcc
 2041 catcgcgcaa cggcaatccc agcagaaact acaaaagcag tgggacgagg aggagacgtg
  2101 ggacgacagc caggcagagg aagtttcaga cgaggaggcg gaggagcaga tggagagctg
 2161 ggacagccta gacgaggagg acctagagga cgtggaggaa gaaaccatcg ccagcgacaa
 2221 ggcaccatct ttcaaaaaac ccgttcggag ccaacctccg aaaactatcc cgcccctgcc
 2281 accgcaacca tgttcactga aagccagccg tag
//