LOCUS L19443 1143 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 10254..11396
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
ORGANISM Human adenovirus F
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1143)
AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
Rozijn,T.H.
TITLE Structure and organization of the left-terminal DNA regions of
fastidious adenovirus types 40 and 41
JOURNAL Gene 58 (1), 109-126 (1987)
PUBMED 2961652
REFERENCE 2 (bases 1 to 1143)
AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
repeat: close relation to that of adenovirus type 5
JOURNAL Virology 156 (2), 414-416 (1987)
PUBMED 3811242
REFERENCE 3 (bases 1 to 1143)
AUTHORS Ishino,M.
TITLE Analysis of structure and function of human adenovirus type 40
leftmost 1.85 kb region including transforming E1A gene
JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 1143)
AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
Sussenbach,J.S.
TITLE The genes encoding the DNA binding protein and the 23K protease of
adenovirus types 40 and 41
JOURNAL Virology 163 (1), 1-10 (1988)
PUBMED 3279700
REFERENCE 5 (bases 1 to 1143)
AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
TITLE Characterization of adenovirus type 40 E1 region
JOURNAL Virology 165 (1), 95-102 (1988)
PUBMED 2968714
REFERENCE 6 (bases 1 to 1143)
AUTHORS Kidd,A.H. and Erasmus,M.J.
TITLE Sequence characterization of the adenovirus 40 fiber gene
JOURNAL Virology 172 (1), 134-144 (1989)
PUBMED 2773314
REFERENCE 7 (bases 1 to 1143)
AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
TITLE The adenovirus type 40 hexon: sequence, predicted structure and
relationship to other adenovirus hexons
JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
PUBMED 2481711
REFERENCE 8 (bases 1 to 1143)
AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
TITLE The DNA sequence of adenovirus type 40
JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
PUBMED 8263936
REFERENCE 9 (bases 1 to 1143)
AUTHORS Davison,A.J., Benko,M. and Harrach,B.
TITLE Genetic content and evolution of adenoviruses
JOURNAL Unpublished
REFERENCE 10 (bases 1 to 1143)
AUTHORS Davison,A.J.
TITLE Direct Submission
JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
G11 5JR, UK
FEATURES Location/Qualifiers
source 1..1143
/organism="Human adenovirus F"
/mol_type="genomic DNA"
/isolate="Dugan"
/db_xref="taxon:130309"
/tissue_lib="ATCC VR-931"
mRNA <1..>1143
/product="52K"
CDS 1..1143
/codon_start=1
/product="52K"
/protein_id="AAC13960.1"
/db_xref="GI:303982"
/translation="MHPVLRQMRPTAPPTQPPLPPPTSAPAAVALSGAGGGNPEEEAI
LDLEEGEGLARLGAPSPERHPRVQLKKDSRQAYVPPQNLFRDRSGQEPEEMRDRRFYA
GQELRAGFNRQRVLRAEDFEPDEHSGISPARAHVSAADLVTAYEQTVNEERNFQKSFN
NHVRTLVAREEVAIGLMHLWDFMEAYVQNPSSKPLTAQLFLIVQHSRDNEAFREAMLN
IAEPEGRWLLDLVNILQSIVVQERSLSLADKVAAINYSMLSLGKFYARKIYKTPYVPI
DKEVKIDSFYMRMALKVLTLSDDLGVYRNDRIHKAVSASRRRELSDRELMHSLRRALT
GTGTDAETESYFDMGADLQWQPSARALEAAGYVGAEEDEEDYEDEP"
ORIGIN
1 atgcatccgg tgttgcgaca gatgcgtccg acggcgcctc caacacagcc gccgctcccg
61 ccccccacta gcgcccctgc agccgttgct ctctccggag ccggcggtgg caaccctgag
121 gaggaggcca tcctggacct ggaagagggc gaggggctgg cccgcttggg ggcgccatcc
181 cccgagcgcc atccccgcgt gcaacttaaa aaggactcac gccaggcgta cgtaccgcct
241 cagaatttat tcagggatcg cagcgggcag gagcccgaag agatgaggga tcgcaggttt
301 tacgcggggc aggagctgcg ggccggtttt aaccgccaac gggtgctacg cgccgaagat
361 tttgaacccg acgaacatag cggaataagt ccggcacggg cgcacgtgtc ggcggccgat
421 ttggtaaccg cgtacgagca aacggtgaac gaggagcgca actttcagaa aagttttaac
481 aatcacgtgc gcaccctggt ggcgcgcgag gaggtggcca ttgggctgat gcatttgtgg
541 gactttatgg aggcgtacgt gcaaaatcct tcgagcaagc cgctgacggc gcagctgttt
601 ttgattgtgc aacacagccg ggacaacgag gctttccgcg aggccatgct gaatattgcg
661 gagcctgagg gtcgctggct tttggacctg gttaatatcc ttcagagcat tgtggtacag
721 gagcgcagtc taagcctggc cgacaaggtg gcggccatta attacagcat gcttagcctc
781 ggcaagtttt acgcccgcaa gatttacaaa accccctatg tgcccataga caaggaggtt
841 aaaatagata gcttttacat gcgcatggcg ctaaaggtgt taacgctgag tgacgatctg
901 ggggtgtacc gcaacgaccg tattcacaaa gctgtgagcg ccagccgccg tcgcgagctt
961 agcgaccgcg aactaatgca cagcctgcgt cgggctctaa cgggcaccgg cactgatgcc
1021 gaaactgaat cttactttga catgggggcg gacctgcaat ggcagcccag cgcccgggcc
1081 ctggaggcgg ctggttatgt tggcgcggaa gaagatgagg aggactatga ggacgagccc
1141 tga
//