LOCUS L19443 1422 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 21100..22521
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
ORGANISM Human adenovirus F
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1422)
AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
Rozijn,T.H.
TITLE Structure and organization of the left-terminal DNA regions of
fastidious adenovirus types 40 and 41
JOURNAL Gene 58 (1), 109-126 (1987)
PUBMED 2961652
REFERENCE 2 (bases 1 to 1422)
AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
repeat: close relation to that of adenovirus type 5
JOURNAL Virology 156 (2), 414-416 (1987)
PUBMED 3811242
REFERENCE 3 (bases 1 to 1422)
AUTHORS Ishino,M.
TITLE Analysis of structure and function of human adenovirus type 40
leftmost 1.85 kb region including transforming E1A gene
JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 1422)
AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
Sussenbach,J.S.
TITLE The genes encoding the DNA binding protein and the 23K protease of
adenovirus types 40 and 41
JOURNAL Virology 163 (1), 1-10 (1988)
PUBMED 3279700
REFERENCE 5 (bases 1 to 1422)
AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
TITLE Characterization of adenovirus type 40 E1 region
JOURNAL Virology 165 (1), 95-102 (1988)
PUBMED 2968714
REFERENCE 6 (bases 1 to 1422)
AUTHORS Kidd,A.H. and Erasmus,M.J.
TITLE Sequence characterization of the adenovirus 40 fiber gene
JOURNAL Virology 172 (1), 134-144 (1989)
PUBMED 2773314
REFERENCE 7 (bases 1 to 1422)
AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
TITLE The adenovirus type 40 hexon: sequence, predicted structure and
relationship to other adenovirus hexons
JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
PUBMED 2481711
REFERENCE 8 (bases 1 to 1422)
AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
TITLE The DNA sequence of adenovirus type 40
JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
PUBMED 8263936
REFERENCE 9 (bases 1 to 1422)
AUTHORS Davison,A.J., Benko,M. and Harrach,B.
TITLE Genetic content and evolution of adenoviruses
JOURNAL Unpublished
REFERENCE 10 (bases 1 to 1422)
AUTHORS Davison,A.J.
TITLE Direct Submission
JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
G11 5JR, UK
FEATURES Location/Qualifiers
source 1..1422
/organism="Human adenovirus F"
/mol_type="genomic DNA"
/isolate="Dugan"
/db_xref="taxon:130309"
/tissue_lib="ATCC VR-931"
mRNA complement(<1..>1422)
/product="DBP"
mRNA complement(<1..>1422)
/product="late DBP"
CDS complement(1..1422)
/codon_start=1
/product="DBP"
/protein_id="AAC13969.1"
/db_xref="GI:303991"
/translation="MAGRQQELPTITPYLQETSPERAPSLPPKKKLRKNVQVPDRVPV
LPPSPEVVPDSEEEEEEVVYTGFSHPGVQVVQKASGKRYVRRLEPKGVPPPSEENNEE
EEPSTSKAVTSVVLNPQAEPLVSAWEKGMDLMIKLMEKYHVEAEEKNGFKFLPEQSNV
YRKICQTWLNEEHRGLPLTFTSHKTFVEMMGRFLRAYVESYAGVKNNEWEPTGCAIWL
HGCTEQEGVLRCYHGLEMIQKEQLVEMDVASENAQRALKEHPSRAKVVQNRWGRSVVQ
LKNDDARCCVEDVSCATNVFSAKSCGLFFSEGTKAQTAFLQIEAFMQAEYPKMQNGLK
RLLMVMRCDCLYKPTGVPQLGRQMCKATPFALSNVDSLRAEEVTDKVALASIQYPCVL
VYQCANPVYRNSRGGQGPNCDFKISAPDLLGALQLVRRLWGENVDGPLPKMLIPEFKW
SSRLQYRNVALPASHGDGEKEPF"
ORIGIN
1 ttaaaatggt tctttctccc catcgccgtg gctggcgggc aaagctacgt tgcgatactg
61 caaacgagag gaccacttaa attctggaat cagcatctta ggaagggggc catcgacgtt
121 ctctccccac agccgtcgta caagttgcaa agctcccaaa aggtcaggtg cagaaatttt
181 gaaatcacag ttgggacctt ggccaccacg ggagttgcgg tatacggggt tagcgcactg
241 gtaaaccagc acacagggat actggatact ggcaagagcc accttgtcgg ttacttcttc
301 agctctaaga ctgtcaacat tgcttagagc gaaaggggtg gctttacaca tttgccgacc
361 caattggggc acaccggtgg gcttgtacag gcagtcgcag cgcatcacca ttaataggcg
421 ttttagcccg ttttgcattt ttggatattc ggcttgcata aaagcttcta tctgcaaaaa
481 agccgtctga gcctttgttc cttccgagaa aaacagaccg caggacttgg cagaaaacac
541 attggtggca cagctcacgt cttctacaca acaacgggca tcgtcattct tcagttgaac
601 cacgctgcgc ccccaccggt tttgtaccac cttggctcga ctcgggtgct cctttaacgc
661 ccgctgagcg ttctcgctcg ctacatccat ttccaccaac tgctcttttt gaatcatttc
721 caggccatga taacagcgta gcactccctc ttgctcggtg cagccgtgaa gccaaatcgc
781 gcaaccagtg ggctcccatt cattgttttt taccccggcg tacgactcca cgtaggctct
841 caaaaaacgt cccatcattt ccacaaatgt cttgtggctg gtgaaggtga gagggaggcc
901 gcgatgctcc tcgttaagcc acgtttggca aattttgcga taaacgttgc tttgttcggg
961 taggaacttg aagccattct tctcttcggc ctccacatga tacttttcca ttagctttat
1021 cattaaatcc atgcctttct cccaggcgga aaccaagggc tctgcctgcg gattaagaac
1081 cactgatgta acagctttgg aagtgctagg ctcttcttcc tcgttgtttt cctctgacgg
1141 gggaggcaca cctttgggct ccaagcgtct tacatatcgc ttgccactgg ccttttgaac
1201 gacctgcacg ccggggtgac tgaacccggt gtacaccacc tcttcttctt cctcctcgct
1261 gtctggaacc acttcgggag acggaggcaa aactggaacg cgatccggca cttgaacatt
1321 cttgcgcaac ttctttttgg gaggaagtga cggggcccgt tctggactcg tctcctgcaa
1381 gtagggagtg atggtgggga gttcttgctg acggccggcc at
//