LOCUS       L19443                   750 bp    DNA     linear   VRL 14-AUG-2003
DEFINITION  Human adenovirus F, complete genome.
ACCESSION   L19443 REGION: join(486..1011,1088..1311)
VERSION     L19443.1  GI:303969
KEYWORDS    .
SOURCE      Human adenovirus F
  ORGANISM  Human adenovirus F
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 750)
  AUTHORS   van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
            Rozijn,T.H.
  TITLE     Structure and organization of the left-terminal DNA regions of
            fastidious adenovirus types 40 and 41
  JOURNAL   Gene 58 (1), 109-126 (1987)
   PUBMED   2961652
REFERENCE   2  (bases 1 to 750)
  AUTHORS   Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
  TITLE     Nucleotide sequence of the adenovirus type 40 inverted terminal
            repeat: close relation to that of adenovirus type 5
  JOURNAL   Virology 156 (2), 414-416 (1987)
   PUBMED   3811242
REFERENCE   3  (bases 1 to 750)
  AUTHORS   Ishino,M.
  TITLE     Analysis of structure and function of human adenovirus type 40
            leftmost 1.85 kb region including transforming E1A gene
  JOURNAL   Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE   4  (bases 1 to 750)
  AUTHORS   Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
            Sussenbach,J.S.
  TITLE     The genes encoding the DNA binding protein and the 23K protease of
            adenovirus types 40 and 41
  JOURNAL   Virology 163 (1), 1-10 (1988)
   PUBMED   3279700
REFERENCE   5  (bases 1 to 750)
  AUTHORS   Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
  TITLE     Characterization of adenovirus type 40 E1 region
  JOURNAL   Virology 165 (1), 95-102 (1988)
   PUBMED   2968714
REFERENCE   6  (bases 1 to 750)
  AUTHORS   Kidd,A.H. and Erasmus,M.J.
  TITLE     Sequence characterization of the adenovirus 40 fiber gene
  JOURNAL   Virology 172 (1), 134-144 (1989)
   PUBMED   2773314
REFERENCE   7  (bases 1 to 750)
  AUTHORS   Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
  TITLE     The adenovirus type 40 hexon: sequence, predicted structure and
            relationship to other adenovirus hexons
  JOURNAL   J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
   PUBMED   2481711
REFERENCE   8  (bases 1 to 750)
  AUTHORS   Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
  TITLE     The DNA sequence of adenovirus type 40
  JOURNAL   J. Mol. Biol. 234 (4), 1308-1316 (1993)
   PUBMED   8263936
REFERENCE   9  (bases 1 to 750)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   Unpublished
REFERENCE   10 (bases 1 to 750)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
FEATURES             Location/Qualifiers
     source          1..750
                     /organism="Human adenovirus F"
                     /mol_type="genomic DNA"
                     /isolate="Dugan"
                     /db_xref="taxon:130309"
                     /tissue_lib="ATCC VR-931"
     mRNA            <1..>750
                     /product="E1A"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             1..750
                     /codon_start=1
                     /product="E1A"
                     /protein_id="AAC13949.1"
                     /db_xref="GI:303971"
                     /translation="MRMLPDFFTGNWDDMFQGLLETEYVFDFPEPSEASEEMSLHDLF
                     DVEVDGFEEDANQEAVDGMFPERLLSEAESAAESGSGDSGVGEELLPVDLDLKCYEDG
                     LPPSDPETDEATEAEEEAAMPTYVNENENELVLDCPENPGRGCRACDFHRGTSGNPEA
                     MCALCYMRLTGHCIYSPISDAEGESESGSPEDTDFPHPLTATPPHGIVRTIPCRVSCR
                     RRPAVECIEDLLEEDPTDEPLNLSLKRPKCS"
ORIGIN      
        1 atgagaatgc tgccggattt ttttaccggg aactgggatg acatgttcca ggggttgctg
       61 gagactgaat atgtgtttga tttccctgaa ccttctgagg cttctgaaga aatgtcgctt
      121 catgatcttt ttgatgtgga ggtggatggt ttcgaagagg acgccaacca ggaagcggtt
      181 gatggtatgt ttcccgagag gttgctgtcc gaggctgaga gcgctgcaga gagcggttcg
      241 ggtgattctg gggttggcga agagttgttg ccggttgatc tggatttgaa atgctatgaa
      301 gacggtttgc ctcctagcga tcctgaaact gatgaggcta cagaggcgga agaagaggcg
      361 gctatgccga cttatgtgaa tgaaaatgaa aatgagctgg tgctggactg tccagagaac
      421 cctgggcgag gttgtcgggc ttgtgatttc catcggggca ctagtggcaa tcctgaagct
      481 atgtgtgctt tgtgttatat gcgtttaact ggacactgta tctacagtcc aatttcagat
      541 gcggaagggg agtctgagtc ggggtcgcct gaggacactg attttcccca ccctttaacc
      601 gccacgccgc cacatggaat tgtgagaacc atcccgtgca gagtttcttg tagacgacgc
      661 ccagctgttg agtgcataga agatttactt gaggaagatc caacagatga acctttgaac
      721 ctgtccttaa agcgccccaa gtgctcctga
//