LOCUS       L19443                  2772 bp    DNA     linear   VRL 14-AUG-2003
DEFINITION  Human adenovirus F, complete genome.
ACCESSION   L19443 REGION: 17643..20414
VERSION     L19443.1  GI:303969
KEYWORDS    .
SOURCE      Human adenovirus F
  ORGANISM  Human adenovirus F
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 2772)
  AUTHORS   van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
            Rozijn,T.H.
  TITLE     Structure and organization of the left-terminal DNA regions of
            fastidious adenovirus types 40 and 41
  JOURNAL   Gene 58 (1), 109-126 (1987)
   PUBMED   2961652
REFERENCE   2  (bases 1 to 2772)
  AUTHORS   Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
  TITLE     Nucleotide sequence of the adenovirus type 40 inverted terminal
            repeat: close relation to that of adenovirus type 5
  JOURNAL   Virology 156 (2), 414-416 (1987)
   PUBMED   3811242
REFERENCE   3  (bases 1 to 2772)
  AUTHORS   Ishino,M.
  TITLE     Analysis of structure and function of human adenovirus type 40
            leftmost 1.85 kb region including transforming E1A gene
  JOURNAL   Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE   4  (bases 1 to 2772)
  AUTHORS   Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
            Sussenbach,J.S.
  TITLE     The genes encoding the DNA binding protein and the 23K protease of
            adenovirus types 40 and 41
  JOURNAL   Virology 163 (1), 1-10 (1988)
   PUBMED   3279700
REFERENCE   5  (bases 1 to 2772)
  AUTHORS   Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
  TITLE     Characterization of adenovirus type 40 E1 region
  JOURNAL   Virology 165 (1), 95-102 (1988)
   PUBMED   2968714
REFERENCE   6  (bases 1 to 2772)
  AUTHORS   Kidd,A.H. and Erasmus,M.J.
  TITLE     Sequence characterization of the adenovirus 40 fiber gene
  JOURNAL   Virology 172 (1), 134-144 (1989)
   PUBMED   2773314
REFERENCE   7  (bases 1 to 2772)
  AUTHORS   Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
  TITLE     The adenovirus type 40 hexon: sequence, predicted structure and
            relationship to other adenovirus hexons
  JOURNAL   J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
   PUBMED   2481711
REFERENCE   8  (bases 1 to 2772)
  AUTHORS   Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
  TITLE     The DNA sequence of adenovirus type 40
  JOURNAL   J. Mol. Biol. 234 (4), 1308-1316 (1993)
   PUBMED   8263936
REFERENCE   9  (bases 1 to 2772)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   Unpublished
REFERENCE   10 (bases 1 to 2772)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
FEATURES             Location/Qualifiers
     source          1..2772
                     /organism="Human adenovirus F"
                     /mol_type="genomic DNA"
                     /isolate="Dugan"
                     /db_xref="taxon:130309"
                     /tissue_lib="ATCC VR-931"
     mRNA            <1..>2772
                     /product="pVI"
     mRNA            <1..>2772
                     /product="hexon"
     mRNA            <2678..>2772
                     /product="protease"
     CDS             1..2772
                     /codon_start=1
                     /product="hexon"
                     /protein_id="AAC13967.1"
                     /db_xref="GI:303989"
                     /translation="MATPSMMPQWSYMHIAGQDASEYLSPGLVQFARATDTYFSLGNK
                     FRNPTVAPTHDVTTDRSQRLTLRFVPVDREETAYSYKVRFTLAVGDNRVLDMASTYFD
                     IRGVLDRGPSFKPYSGTAYNSLAPKGAPNPSQWTNQNKTNSFGQAPYIGQKITNQGVQ
                     VGSDSNNRDVFADKTYQPEPQVGQTQWNINPMQNAAGRILKQTTPMQPCYGSYARPTN
                     EKGGQAKLVKNDDNQTTTTNVGLNFFTTATETANFSPKVVLYSEDVNLEAPDTHLVFK
                     PDVNGTSAELLLGQQAAPNRPNYIGFRDNFIGLMYYNSTGNMGVLAGQASQLNAVVDL
                     QDRNTELSYQLMLDALGDRSRYFSMWNQAVDSYDPDVRIIENHGVEDELPNYCFPLNG
                     QGISNSYQGVKTDNGTNWSQNNTDVSSNNEISIGNVFAMEINLAANLWRSFLYSNVAL
                     YLPDSYKITPDNITLPDNKNTYAYMNGRVAVPSALDTYVNIGARWSPDPMDNVNPFNH
                     HRNAGLRYRSMLLGNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMILQS
                     SLGNDLRVDGASVRFDSINLYANFFPMAHNTASTLEAMLRNDTNDQSFNDYLCAANML
                     YPIPANATSVPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFTYSGSVPYLDGT
                     FYLNHTFKKVSVMFDSSVSWPGNDRLLTPNEFEIKRTVDGEGYNVAQCNMTKDWFLIQ
                     MLSHYNIGYQGFHVPESYKDRMYSFFRNFQPMSRQVVDTTTYTEYQNVTLPFQHNNSG
                     FVGYMGPAIREGQAYPANYPYPLIGQTAVPSLTQKKFLCDRTMWRIPFSSNFMSMGAL
                     TDLGQNMLYANSAHALDMTFEVDPMDEPTLLYVLFEVFDVVRIHQPHRGVIEAVYLRT
                     PFSAGNATT"
ORIGIN      
        1 atggccaccc cctcgatgat gccgcaatgg tcttacatgc acatcgccgg gcaggacgcc
       61 tcggagtacc tgagcccggg cctggtgcag ttcgcccgtg ccaccgatac ctacttcagc
      121 ctggggaaca agttcagaaa ccccaccgtg gctcccaccc acgatgtaac cacagacagg
      181 tcgcagcgac tgacgctgcg cttcgtgccc gtcgaccgcg aggaaaccgc ctactcttac
      241 aaagtgcgct ttacgctggc cgtgggcgac aaccgggttt tggacatggc cagcacctac
      301 tttgacatcc gcggcgtgct ggatcgtggt cccagcttta aaccctattc gggcactgca
      361 tacaactccc tggcccccaa aggtgctccc aatcctagcc agtggacaaa ccaaaacaaa
      421 acaaactcct ttggacaagc tccctatata ggacaaaaaa tcaccaatca gggcgtgcaa
      481 gtgggctcag actccaacaa tcgcgatgtg tttgccgata aaacgtacca accggagcct
      541 caagtggggc agacgcaatg gaacattaat ccaatgcaaa acgctgcggg aagaatacta
      601 aaacaaacca cgcccatgca gccatgttat gggtcatacg ctagaccaac aaacgaaaaa
      661 ggaggtcaag ccaagctggt aaaaaatgac gacaatcaga ccacaacaac aaacgtaggt
      721 ttaaactttt ttaccactgc cactgaaacc gctaattttt caccaaaggt ggttctgtac
      781 agcgaagatg ttaacttaga agcgcccgat acccaccttg tgtttaagcc agatgtcaac
      841 ggcacaagtg ccgagctttt actgggacag caggccgctc ccaatcgacc taattacatt
      901 ggttttaggg acaacttcat tggtttgatg tactacaatt ccactggcaa catgggagtg
      961 ctggccgggc aagcttctca gctcaacgca gtggtggact tacaagatag aaacacggag
     1021 ctgtcttacc agttaatgct tgacgcttta ggggatcgga gtcgatactt ctccatgtgg
     1081 aaccaggcag tggacagcta tgacccagac gtgagaatta ttgaaaatca tggcgtggaa
     1141 gacgagctcc ccaactattg ctttcctctt aatgggcaag gaatatctaa cagttaccaa
     1201 ggcgtaaaga ctgacaatgg aactaactgg tctcagaata atacagacgt ctcaagcaac
     1261 aacgaaattt ccattggcaa tgtgtttgcc atggagatta atctggcggc taacttgtgg
     1321 agaagcttct tgtactcaaa tgtagccctg tacttgcctg actcttacaa aataaccccc
     1381 gataacatta ctttacccga caacaaaaat acatatgcct acatgaacgg tcgggttgcc
     1441 gtccccagcg ccctggatac atacgtgaac attggggcgc ggtggtctcc agaccccatg
     1501 gacaacgtta atccctttaa ccaccaccgc aatgctggtc tgcgctaccg ttctatgctc
     1561 ctgggtaacg gccgctacgt gccttttcac atccaagtgc cccagaaatt tttcgccatt
     1621 aaaaatctcc tgctcctgcc cgggtcctac acctatgagt ggaacttccg gaaggatgtt
     1681 aacatgattc tccaaagcag tctcggtaac gacctcaggg tcgatggagc cagcgtcagg
     1741 tttgacagca ttaacctgta tgccaacttt ttccccatgg ctcacaacac cgcttccacc
     1801 ttggaagcaa tgcttcgtaa tgataccaac gatcagtctt tcaacgacta cctctgcgct
     1861 gcaaacatgc tttaccccat acccgccaac gctactagcg tgcccatttc tattccttcg
     1921 cgaaattggg ctgcttttcg ggggtggagt tttactagac taaaaactaa agaaaccccc
     1981 tctttggggt ccgggtttga tccatatttc acctactctg gctccgtccc atacttggat
     2041 ggcacctttt acctgaacca cacttttaaa aaggtgtccg ttatgttcga ctcctctgtg
     2101 agctggcctg gtaacgaccg actacttact cccaacgagt ttgaaatcaa acgaaccgtg
     2161 gatggggaag gatacaacgt ggctcaatgt aacatgacca aggactggtt cctcatacaa
     2221 atgctcagtc actacaatat tggctaccag ggtttccacg taccagaaag ctacaaggac
     2281 aggatgtact cctttttccg aaacttccaa cccatgagcc gccaggtggt agacactacc
     2341 acctacacgg agtatcagaa tgtaactctc cctttccagc ataataactc tggctttgta
     2401 ggatacatgg gacctgccat acgggaggga caagcttacc ccgccaacta tccatacccc
     2461 cttattggtc agacggccgt accaagcctg actcagaaaa aatttctttg cgatcgtacc
     2521 atgtggcgca ttcccttttc cagcaacttt atgtctatgg gggccctgac cgacctgggg
     2581 caaaacatgc tgtacgccaa ctccgcccac gcgctcgaca tgacttttga ggtggacccc
     2641 atggatgagc ccacacttct ctatgttctg ttcgaagttt tcgacgttgt gcgcatccac
     2701 cagccgcacc gcggcgtcat cgaggccgtc tacctgcgta cgccgttctc ggccggtaac
     2761 gccaccacat aa
//