LOCUS L19443 1515 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 13241..14755
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
 ORGANISM Human adenovirus F
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1515)
 AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
 Rozijn,T.H.
 TITLE Structure and organization of the left-terminal DNA regions of
 fastidious adenovirus types 40 and 41
 JOURNAL Gene 58 (1), 109-126 (1987)
 PUBMED 2961652
REFERENCE 2 (bases 1 to 1515)
 AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
 TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
 repeat: close relation to that of adenovirus type 5
 JOURNAL Virology 156 (2), 414-416 (1987)
 PUBMED 3811242
REFERENCE 3 (bases 1 to 1515)
 AUTHORS Ishino,M.
 TITLE Analysis of structure and function of human adenovirus type 40
  leftmost 1.85 kb region including transforming E1A gene
 JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 1515)
 AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
 Sussenbach,J.S.
 TITLE The genes encoding the DNA binding protein and the 23K protease of
 adenovirus types 40 and 41
 JOURNAL Virology 163 (1), 1-10 (1988)
 PUBMED 3279700
REFERENCE 5 (bases 1 to 1515)
 AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
 TITLE Characterization of adenovirus type 40 E1 region
 JOURNAL Virology 165 (1), 95-102 (1988)
 PUBMED 2968714
REFERENCE 6 (bases 1 to 1515)
 AUTHORS Kidd,A.H. and Erasmus,M.J.
 TITLE Sequence characterization of the adenovirus 40 fiber gene
 JOURNAL Virology 172 (1), 134-144 (1989)
 PUBMED 2773314
REFERENCE 7 (bases 1 to 1515)
 AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
 TITLE The adenovirus type 40 hexon: sequence, predicted structure and
 relationship to other adenovirus hexons
 JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
 PUBMED 2481711
REFERENCE 8 (bases 1 to 1515)
 AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
 TITLE The DNA sequence of adenovirus type 40
 JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
 PUBMED 8263936
REFERENCE 9 (bases 1 to 1515)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL Unpublished
REFERENCE 10 (bases 1 to 1515)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
FEATURES Location/Qualifiers
 source 1..1515
 /organism="Human adenovirus F"
 /mol_type="genomic DNA"
 /isolate="Dugan"
 /db_xref="taxon:130309"
 /tissue_lib="ATCC VR-931"
 mRNA complement(<1..136)
 /product="pol"
 mRNA complement(<1..136)
 /product="pTP"
 mRNA <1..>1515
 /product="III"
 mRNA <1373..>1515
 /product="pVII"
 CDS 1..1515
 /codon_start=1
 /product="III"
 /protein_id="AAC13962.1"
 /db_xref="GI:303984"
 /translation="MRRAVGVPPVMAYAEGPPPSYESVMETADLPATLQALHVPPRYL
 GPTEGRNSIRYSELAPLYDTTRVYLVDNKSADIASLNYQNDHSNFQTTVVQNNDFTPT
 EAGTQTINFDDRSRWGGDLKTILRTNMPNINEFMSTNKFRARVMVEKVNRKTNAPRYE
 WFEFTLPEGNYSETMTIDLMNNAIVDNYLAVGRQNGVLESDIGVKFDTRNFRLGWDPV
 TKLVMPGVYTNEAFHPDIVLLPGCGVDFTQSRLNNLLGIRKRMPFQKGFQIMYEDLEG
 GNIPALLDVEKYEASIKEAQEIRGADFKPNPQDLEIVPVEKDSKERSYNLLEGDKNNT
 AYRSWFLAYNYGDAEKGVKSWTLLTTTDVTCGSQQVYWSLPDMMQDPVTFRPSTQVSN
 YPVVGVELLPVHAKSFYNEQAVYSQLIRQSTALTHIFNRFPENQILVRPPAPTITTVS
  ENVPALTDHGTLPLRSSISGVQRVTITDARRRTCPYVHKALGIVAPKVLSSRTF"
ORIGIN 
 1 atgagacgtg cggtgggagt gccgccggtg atggcgtacg ccgagggtcc tcctccttct
 61 tacgaaagcg tgatggaaac agcggatttg ccggcaacgc tgcaggcgct ccacgtccct
 121 ccccgttacc tggggcctac ggaagggcgg aacagcatac gttactcgga gctggcgcct
 181 ctatacgaca ccacccgggt ttacctggtg gacaacaagt cggcggacat tgcctccctg
 241 aactaccaga acgaccatag taactttcaa accacggtgg tacaaaataa tgactttacc
 301 ccgacagagg ccggtaccca gaccatcaat tttgacgatc gctccaggtg gggcggcgac
 361 ctgaaaacca ttttgcgcac caatatgccc aacatcaatg agtttatgtc taccaacaag
 421 tttcgggcgc gggtgatggt agaaaaagtg aaccggaaaa ccaacgctcc tcgttacgag
 481 tggttcgagt tcactttgcc agagggcaac tattcggaaa ctatgactat agaccttatg
 541 aataacgcga tcgtagacaa ctacttagca gtaggacgtc agaacggcgt gctggaaagc
 601 gacattgggg tgaagtttga cacgcgcaac ttccggttgg gttgggatcc cgtaaccaag
 661 ttggtgatgc ccggcgtgta caccaacgag gcctttcacc cagacattgt tttgctacct
 721 ggttgcggcg tggatttcac gcaaagtcgt ctgaacaact tgctaggaat acgcaagcga
 781 atgccctttc aaaaaggttt ccaaatcatg tatgaggatt tggagggcgg caacattcct
 841 gctctattag atgtggaaaa gtacgaagct agcataaaag aagcacagga gatccgtgga
 901 gccgacttca agcccaatcc tcaagacttg gaaatcgtgc ccgtggaaaa agacagcaag
 961 gaaagaagtt acaatctcct agagggagat aaaaataaca ctgcctaccg cagctggttt
 1021 ttggcctaca actacggaga tgcagagaaa ggagtaaagt cttggacctt gttaacaacc
 1081 acggatgtga cctgtgggtc gcagcaggtg tactggtccc ttcccgacat gatgcaagat
 1141 ccagtaacgt ttcgaccgtc cacgcaagtc agcaactacc ctgtagtggg ggtggaatta
 1201 ctgccagtac atgccaagag tttttacaac gagcaggccg tgtattctca gcttattcgc
 1261 cagtccaccg cgcttacgca catcttcaat cgttttcctg agaatcagat actagtgcgt
 1321 ccgcccgctc cgaccattac caccgtcagt gaaaacgttc ccgccctcac agatcacgga
 1381 accctgccgc tgcgcagcag tatcagtgga gttcagcgcg tgaccatcac tgacgcccgc
 1441 cgtcggacct gcccctacgt gcacaaagct ctgggcatag ttgctcccaa agtgctgtct
 1501 agccgcacgt tttaa
//