LOCUS L19443 399 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 3217..3615
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
 ORGANISM Human adenovirus F
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 399)
 AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
 Rozijn,T.H.
 TITLE Structure and organization of the left-terminal DNA regions of
 fastidious adenovirus types 40 and 41
 JOURNAL Gene 58 (1), 109-126 (1987)
 PUBMED 2961652
REFERENCE 2 (bases 1 to 399)
 AUTHORS  Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
 TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
 repeat: close relation to that of adenovirus type 5
 JOURNAL Virology 156 (2), 414-416 (1987)
 PUBMED 3811242
REFERENCE 3 (bases 1 to 399)
 AUTHORS Ishino,M.
 TITLE Analysis of structure and function of human adenovirus type 40
 leftmost 1.85 kb region including transforming E1A gene
 JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 399)
 AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
 Sussenbach,J.S.
 TITLE The genes encoding the DNA binding protein and the 23K protease of
 adenovirus types 40 and 41
 JOURNAL Virology 163 (1), 1-10 (1988)
 PUBMED 3279700
REFERENCE 5 (bases 1 to 399)
 AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
 TITLE Characterization of adenovirus type 40 E1 region
 JOURNAL Virology 165 (1), 95-102 (1988)
 PUBMED 2968714
REFERENCE 6 (bases 1 to 399)
 AUTHORS Kidd,A.H. and Erasmus,M.J.
 TITLE Sequence characterization of the adenovirus 40 fiber gene
 JOURNAL Virology 172 (1), 134-144 (1989)
 PUBMED 2773314
REFERENCE 7 (bases 1 to 399)
 AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
 TITLE The adenovirus type 40 hexon: sequence, predicted structure and
 relationship to other adenovirus hexons
 JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
 PUBMED 2481711
REFERENCE 8 (bases 1 to 399)
 AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
 TITLE The DNA sequence of adenovirus type 40
 JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
 PUBMED 8263936
REFERENCE 9 (bases 1 to 399)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL Unpublished
REFERENCE 10 (bases 1 to 399)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
FEATURES Location/Qualifiers
 source 1..399
 /organism="Human adenovirus F"
 /mol_type="genomic DNA"
 /isolate="Dugan"
 /db_xref="taxon:130309"
 /tissue_lib="ATCC VR-931"
 mRNA <1..>399
 /product="E1B"
 /experiment="experimental evidence, no additional details
 recorded"
 mRNA <1..>399
 /product="IX"
 /experiment="experimental evidence, no additional details
 recorded"
 CDS 1..399
 /codon_start=1
 /product="IX"
  /protein_id="AAC13959.1"
 /db_xref="GI:303981"
 /translation="MSGFTEGNAVSFEGGVFSPYLTTRLPSWAGVRQNVVGSNVDGRP
  VAPANSTTLTYATIGSSVDTAAAAAASAAASTARGMAADFGLYNQLAASRLREEDALS
 VVLTRLEELSQQLQDMSAKMALLNPPANTS"
 polyA_signal 398..>399
 /note="for E1B and IX"
ORIGIN 
 1 atgagtggct tcacggaagg aaacgctgtg agttttgagg gtggggtgtt tagcccatat
 61 ctgacaaccc gtcttccctc ttgggcagga gtgcgtcaga atgtggtggg gtccaacgtt
 121 gatggtcgtc ctgtcgcccc tgccaactcg acaaccctta cctacgccac tattggatcg
 181 tcggtggata ccgctgcagc tgctgccgcg tctgctgctg cctctactgc tcgtggcatg
 241 gcagcagatt ttggactgta caatcaactg gccgcgtctc ggttaagaga agaagatgcc
 301 ctgtccgtgg tgttgacccg cttggaggag ctgtctcagc agttgcaaga tatgtctgcc
 361 aaaatggctc tgcttaaccc tcccgctaat acttcttaa
//