LOCUS L19443 1077 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 15380..16456
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
 ORGANISM Human adenovirus F
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1077)
 AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
 Rozijn,T.H.
 TITLE Structure and organization of the left-terminal DNA regions of
 fastidious adenovirus types 40 and 41
 JOURNAL Gene 58 (1), 109-126 (1987)
 PUBMED 2961652
REFERENCE 2 (bases 1 to 1077)
 AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
 TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
 repeat: close relation to that of adenovirus type 5
 JOURNAL Virology 156 (2), 414-416 (1987)
 PUBMED 3811242
REFERENCE 3 (bases 1 to 1077)
 AUTHORS Ishino,M.
 TITLE Analysis of structure and function of human adenovirus type 40
 leftmost 1.85 kb region including transforming E1A gene
 JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 1077)
 AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
 Sussenbach,J.S.
 TITLE The genes encoding the DNA binding protein and the 23K protease of
 adenovirus types 40 and 41
 JOURNAL Virology 163 (1), 1-10 (1988)
 PUBMED 3279700
REFERENCE 5 (bases 1 to 1077)
 AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
 TITLE Characterization of adenovirus type 40 E1 region
 JOURNAL Virology 165 (1), 95-102 (1988)
 PUBMED 2968714
REFERENCE 6 (bases 1 to 1077)
 AUTHORS Kidd,A.H. and Erasmus,M.J.
 TITLE Sequence characterization of the adenovirus 40 fiber gene
 JOURNAL Virology 172 (1), 134-144 (1989)
 PUBMED 2773314
REFERENCE 7 (bases 1 to 1077)
 AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
 TITLE The adenovirus type 40 hexon: sequence, predicted structure and
 relationship to other adenovirus hexons
 JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
 PUBMED 2481711
REFERENCE 8 (bases 1 to 1077)
 AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
 TITLE The DNA sequence of adenovirus type 40
 JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
 PUBMED 8263936
REFERENCE 9 (bases 1 to 1077)
 AUTHORS Davison,A.J., Benko,M. and Harrach,B.
 TITLE Genetic content and evolution of adenoviruses
 JOURNAL Unpublished
REFERENCE 10 (bases 1 to 1077)
 AUTHORS Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
FEATURES Location/Qualifiers
 source 1..1077
 /organism="Human adenovirus F"
 /mol_type="genomic DNA"
 /isolate="Dugan"
 /db_xref="taxon:130309"
 /tissue_lib="ATCC VR-931"
 mRNA <1..>1077
 /product="III"
 mRNA <1..>1077
 /product="pVII"
 mRNA <1..>1077
 /product="V"
 CDS 1..1077
 /codon_start=1
 /product="V"
 /protein_id="AAC13964.1"
 /db_xref="GI:303986"
 /translation="MSKRKFKEELLEALVPEIYGPAADVKPDIKPRVLKRVKKREKKE
 EKEEAGLLDDGVEFVRSFAPRRRVQWRGRKVQRVLRPGTTVVFTPGERSVTRALKRDY
 DEVYADEDILEQAAQQVGEFAYGKRGRYGELGLLLDQSNPTPSLKPATAQQILPVTEI
  KRGVKRENKDELQPTMQLMVPKRQKLEEVLENMKVDPSVEPEVKVRPIKEIGPGLGVQ
 TVDIQIPVRASSSTVSTAVEAMETQPELPEAVARAVAATREMGLQTDPWYEFVAPTSR
 PRSRKYTTANSILPEYALHPSITPTPGYRGTTFKPSRTRSTRRRRSVRRRSRRTAPIS
 VRRVTRRGRTLTLPNARYHPSILV"
ORIGIN 
 1 atgagcaagc gcaagttcaa agaagagctg ctggaggccc ttgtgcctga aatctatggc
 61 cctgccgcgg acgtcaagcc cgacattaag cctcgcgtgc tcaagcgggt taaaaagcga
 121 gaaaaaaaag aggaaaagga ggaagcaggg ttgctagacg acggtgttga gtttgtgcgg
 181 tcctttgccc cccggcggcg ggtgcagtgg cggggacgta aagtccagcg cgtgcttaga
 241 cccggcacta ctgtagtatt tactcccgga gagcggtccg tcacgcgggc cttaaaacgg
 301 gattacgatg aggtttacgc tgacgaagac attcttgagc aggccgccca acaggttggg
 361 gaattcgcct acggcaagcg cggccgctac ggagagttgg gactcttgct ggaccaaagc
 421 aaccccacgc caagcctgaa gcccgcaacg gcgcagcaga tccttcccgt gacagaaatc
 481 aagcggggcg tcaagaggga aaacaaagac gaattgcagc ccaccatgca actcatggtg
 541 ccaaagcggc aaaagcttga ggaggtgttg gagaacatga aagtggatcc cagcgttgag
 601 ccggaagtta aagtgcgccc cattaaagaa atagggcccg gacttggcgt gcagacggtg
 661 gatatccaaa tccccgtgcg tgcgtcttcg tccaccgtta gcactgcggt ggaggccatg
 721 gaaacgcagc ctgagctgcc agaggccgta gcccgtgcgg ttgcggccac gcgagagatg
 781 ggtttgcaaa cggatccgtg gtacgaattc gtggccccta ccagccgtcc acgctcccgg
 841 aaatacacaa ccgctaattc gattttaccg gagtatgcct tgcatccatc catcacgcca
 901 acgcccggtt accgcggaac aaccttcaaa cccagccgca ctcgctccac ccgccgtcgt
 961 cgctctgtcc gccgccgctc aaggcgcacg gcccccatct ctgtgcgtcg cgtaacccgc
 1021 cgtggacgca cgctgaccct tcccaacgcg cgttaccacc ctagcattct cgtttaa
//