LOCUS L19443 804 bp DNA linear VRL 14-AUG-2003
DEFINITION Human adenovirus F, complete genome.
ACCESSION L19443 REGION: 16745..17548
VERSION L19443.1 GI:303969
KEYWORDS .
SOURCE Human adenovirus F
ORGANISM Human adenovirus F
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 804)
AUTHORS van Loon,A.E., Ligtenberg,M., Reemst,A.M., Sussenbach,J.S. and
Rozijn,T.H.
TITLE Structure and organization of the left-terminal DNA regions of
fastidious adenovirus types 40 and 41
JOURNAL Gene 58 (1), 109-126 (1987)
PUBMED 2961652
REFERENCE 2 (bases 1 to 804)
AUTHORS Ishino,M., Sawada,Y., Yaegashi,T., Demura,M. and Fujinaga,K.
TITLE Nucleotide sequence of the adenovirus type 40 inverted terminal
repeat: close relation to that of adenovirus type 5
JOURNAL Virology 156 (2), 414-416 (1987)
PUBMED 3811242
REFERENCE 3 (bases 1 to 804)
AUTHORS Ishino,M.
TITLE Analysis of structure and function of human adenovirus type 40
leftmost 1.85 kb region including transforming E1A gene
JOURNAL Sapporo Igaku Zasshi 57, 59-66 (1988)
REFERENCE 4 (bases 1 to 804)
AUTHORS Vos,H.L., van der Lee,F.M., Reemst,A.M., van Loon,A.E. and
Sussenbach,J.S.
TITLE The genes encoding the DNA binding protein and the 23K protease of
adenovirus types 40 and 41
JOURNAL Virology 163 (1), 1-10 (1988)
PUBMED 3279700
REFERENCE 5 (bases 1 to 804)
AUTHORS Ishino,M., Ohashi,Y., Emoto,T., Sawada,Y. and Fujinaga,K.
TITLE Characterization of adenovirus type 40 E1 region
JOURNAL Virology 165 (1), 95-102 (1988)
PUBMED 2968714
REFERENCE 6 (bases 1 to 804)
AUTHORS Kidd,A.H. and Erasmus,M.J.
TITLE Sequence characterization of the adenovirus 40 fiber gene
JOURNAL Virology 172 (1), 134-144 (1989)
PUBMED 2773314
REFERENCE 7 (bases 1 to 804)
AUTHORS Toogood,C.I., Murali,R., Burnett,R.M. and Hay,R.T.
TITLE The adenovirus type 40 hexon: sequence, predicted structure and
relationship to other adenovirus hexons
JOURNAL J. Gen. Virol. 70 (Pt 12), 3203-3214 (1989)
PUBMED 2481711
REFERENCE 8 (bases 1 to 804)
AUTHORS Davison,A.J., Telford,E.A., Watson,M.S., McBride,K. and Mautner,V.
TITLE The DNA sequence of adenovirus type 40
JOURNAL J. Mol. Biol. 234 (4), 1308-1316 (1993)
PUBMED 8263936
REFERENCE 9 (bases 1 to 804)
AUTHORS Davison,A.J., Benko,M. and Harrach,B.
TITLE Genetic content and evolution of adenoviruses
JOURNAL Unpublished
REFERENCE 10 (bases 1 to 804)
AUTHORS Davison,A.J.
TITLE Direct Submission
JOURNAL Submitted (26-JUL-1993) MRC Virology Unit, Church Street, Glasgow
G11 5JR, UK
FEATURES Location/Qualifiers
source 1..804
/organism="Human adenovirus F"
/mol_type="genomic DNA"
/isolate="Dugan"
/db_xref="taxon:130309"
/tissue_lib="ATCC VR-931"
mRNA <1..>804
/product="pVI"
CDS 1..804
/codon_start=1
/product="pVI"
/protein_id="AAC13966.1"
/db_xref="GI:303988"
/translation="MEDINFASLAPRHGSRPFMGTWNEIGTSQLNGGAFSWSSLWSGI
KNFGSSIKSFGNKAWNSNTGQMLRDKLKDQNFQQKVVDGLASGINGVVDIANQALQNQ
INQRLENSRQPPVALQQRPPPKVEEVEVEEKLPPLEVAPPLPSKGEKRPRPDLEETLV
VESREPPSYEQALKEGASPYPMTKPIGSMARPVYGKESKPVTLELPPPVPTVPPMPAP
TLGTAVSRPTAPTVAVATPARRPRGANWQSTLNSIVGLGVKSLKRRRCY"
ORIGIN
1 atggaagaca tcaattttgc gtcgctggct ccgcggcacg gctcgcggcc gtttatgggc
61 acctggaacg agatcggcac cagccagctc aacgggggcg ctttcagttg gagcagcctg
121 tggagtggca ttaaaaactt tgggtcctcc attaagtcat ttggtaacaa ggcctggaac
181 agtaacacag gtcaaatgct ccgggataag ctaaaggacc aaaactttca acaaaaagtc
241 gtggacgggc tggcttccgg cattaacggc gtggtggata tagccaacca ggccttgcaa
301 aaccaaatca atcagcggct ggaaaatagc cgccagcctc cggtggctct gcagcagcgc
361 ccgcctccca aagtcgagga ggtagaagtg gaggaaaaac taccgccttt ggaggtggca
421 ccccccctgc ctagtaaagg cgaaaagcgg ccgcgaccgg atctggagga aaccctagtt
481 gtggaatccc gcgagccccc ctcgtacgag caggctttga aagagggcgc ttcaccttat
541 cccatgacca aacctattgg ttccatggcc cgacctgtat acgggaagga aagcaaaccc
601 gtgaccttag aactacctcc acccgtgccc accgttccgc ccatgccggc tccgacgctt
661 ggcaccgccg tttctcgccc caccgccccc actgttgccg tggctacccc cgcccgccgc
721 cctcgcgggg ctaactggca gagcactctt aacagcattg tgggtctggg agtaaaaagc
781 ctgaaacgcc gccggtgcta ttaa
//