LOCUS DQ923122 618 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 20115..20732
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 618)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
  Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 618)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
  JOURNAL Unpublished
REFERENCE 3 (bases 1 to 618)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 618)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 618)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..618
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
  /db_xref="taxon:332179"
 /country="USA"
 CDS 1..618
 /codon_start=1
 /product="protease"
 /protein_id="ABK35045.1"
 /db_xref="GI:117503051"
 /translation="MGSSEQELQAIVHDLGCGPYFLGTFDKRFPGFMSPHKPACAIVN
 TAGRETGGVHWLAFAWXPRNRTCYLFDPFGFSDERLKQIYQFEYEGLLKRSALASTPD
 HCVTLEKSTQTVQGPFSAACGLFCCMFLHAFVHWPHTPMDHNPTMDLLTGVPNSMLHS
 PQVAPTLRRNQEHLYRFLGKHSAYFRRHRQRIERATAFESMSQRV"
ORIGIN 
 1 atgggctcca gcgaacagga gctgcaggcc attgttcacg acctgggctg cgggccctac
 61 tttttgggca ccttcgacaa gcggttcccc ggcttcatgt ccccccacaa gccggcctgt
 121 gccatcgtta acacggccgg acgggaaacc gggggggtcc actggctcgc cttcgcctgg
 181 arcccgcgta accgcacctg ctacctgttc gacccttttg gtttctccga cgaaaggctg
 241 aagcagatct accagttcga gtacgagggg ctcctcaagc gcagcgctct ggcctccacg
 301 cccgaccact gcgtcaccct ggaaaagtcc acccagacgg tccaggggcc cttctcggcc
 361 gcctgcgggc tattctgttg catgtttttg cacgccttcg tgcactggcc tcacaccccc
 421 atggatcaca accccaccat ggatctgctc accggagtgc ccaacagcat gcttcacagc
 481 ccccaggtcg cccccaccct gcgccgtaac caggaacacc tgtatcgctt tctggggaaa
 541 cactctgcct attttcgccg ccaccggcag cgcatcgaac gggccacggc cttcgaaagc
 601 atgagccaaa gagtgtaa
//