LOCUS DQ923122 1128 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 10190..11317
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 1128)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
 Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 1128)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 1128)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 1128)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 1128)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..1128
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
 /db_xref="taxon:332179"
 /country="USA"
 gene complement(<1..>1128)
 /gene="pol"
 gene complement(<1..>1128)
 /gene="pTP"
 gene 1..1128
 /gene="52k"
 CDS 1..1128
 /gene="52k"
 /codon_start=1
  /product="52k"
 /protein_id="ABK35037.1"
 /db_xref="GI:117503043"
 /translation="MHPVLRQMRPQTPTTTAAAAVNLSGGGDREEEELALDLEEGEGL
 ARLGAPSPERHPRVQLVRDARQAFVPKQNLFRDRSGQEAEEMRDCRFRAGRELRAGFD
 RERLLRAEDFEPDERSGVSPARAHVSAANLVSAYEQTVNEERNFQKSFNNHVRTLIAR
 EEVTIGLMHLWDFVEAYVQNPASKPLTAQLFLIVQHSRDNETFRDAMLNIAEPEGRWL
 LDLINILQSIVVQERGLSLADKVAAINYSMQSLGKFYARKIYKSPYVPIDKEVKIDSF
 YMRMALKVLTLSDDLGVYRNDKIHKAVSASRRRELSDRELMHSLQRALAGAGDEEREA
 YFDMGADLQWRPSARALEAAGYPDEEDRDDLEEAGEYEDEA"
ORIGIN 
 1 atgcatccgg tgctgcggca gatgcgaccc cagacgccca ccaccaccgc cgcggcggca
 61 gtaaacctga gcggaggcgg tgacagggag gaggaggagc tggctttaga cctggaagag
 121 ggagaggggc tggcccggct gggagcgccg tccccagaga gacaccctag ggttcagctc
  181 gtgagggacg ccaggcaggc ttttgtgccg aagcagaacc tgtttaggga ccgcagcggt
 241 caggaggcgg aggagatgcg cgattgcagg tttcgggcgg gtagagagct gagggcgggc
 301 ttcgatcggg agcggctcct gagggcggag gatttcgagc ccgacgagcg ttctggggtg
 361 agcccggccc gcgctcacgt ctcggcggcc aacctggtga gcgcgtacga gcagacggtg
 421 aacgaggagc gcaacttcca aaagagcttt aacaatcacg tgaggaccct gatcgcgagg
 481 gaggaggtga ccatcgggct gatgcatctg tgggacttcg tggaggccta cgtgcagaac
 541 ccggccagca aacctctgac ggcccagctg ttcctgatcg tgcagcacag ccgcgacaac
 601 gaaacgttcc gcgacgccat gttgaacatc gcggagcccg agggtcgctg gctcttggat
 661 ctgattaaca tcctgcagag catcgtggtg caggagaggg gcctgagttt agcggacaag
 721 gtggcggcca ttaactattc gatgcagagc ctggggaagt tctacgctcg caagatctac
 781 aagagccctt acgtgcccat agacaaggag gtgaagatag acagctttta catgcgcatg
 841 gcgctgaagg tgctgacgct gagcgacgac ctcggcgtgt accgtaacga caagatccac
 901 aaggcggtga gcgccagccg ccggcgggag ctgagcgaca gggagctgat gcacagcctg
 961 cagagggcgc tggcgggcgc cggggacgag gagcgcgagg cttacttcga catgggagcc
 1021 gatctgcagt ggcgtcccag cgcgcgcgcc ttggaggcgg cgggctaccc cgacgaggag
 1081 gatcgggacg atttggagga ggcaggcgag tacgaggacg aagcctga
//