LOCUS DQ923122 702 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: join(475..964,1048..1259)
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 702)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
  Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 702)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
  JOURNAL Unpublished
REFERENCE 3 (bases 1 to 702)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 702)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 702)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..702
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
 /db_xref="taxon:332179"
 /country="USA"
 gene <1..>702
 /gene="E1A"
 CDS 1..702
 /gene="E1A"
 /codon_start=1
 /product="E1A"
 /protein_id="ABK35030.1"
 /db_xref="GI:117503036"
  /translation="MRLVPEMYGVFCSETVRNSDELLNTDLLDVPNSPVTSPPSLHDL
 FDVEVDPPQDPNEDAVNSMFPECLFEAAEEGSHSSEESKRGEELDLKCYEECLPSSDS
 ETEQTGGDGCTEPVVKNEPVLDRPDQPGHGCRACAFHRNASGNPETLCALCYLRLTSD
 FVYSDVSDAEGDGDRSGSANSPCTLGAVVPVGIIKPVAVRVSGRRCAVEKLEDLLQEE
 QTEPLDLSMKRPKLT"
ORIGIN 
 1 atgaggctgg tccccgagat gtacggtgtt ttctgcagcg agacggtccg gaactcagat
 61 gagctgctta atacagatct gctggatgtt cccaactcgc ctgtgacttc gcctccgtcg
 121 cttcatgatc ttttcgatgt ggaagtggat ccaccgcaag atcccaacga ggacgcggta
 181 aacagtatgt tccctgaatg tctgtttgag gcggctgagg agggttctca cagcagtgaa
 241 gagagcaaac ggggagagga actggacttg aaatgctacg aggaatgtct gccttctagc
 301 gattctgaaa cggaacaaac agggggagac ggctgtactg agccggtagt gaaaaatgaa
 361 cctgtattag accgtcctga tcaacctggt catggctgcc gtgcctgtgc ttttcataga
 421 aatgccagcg gaaatcctga aactctatgt gctctgtgtt acctgcgtct taccagcgat
 481 tttgtataca gtgacgtgtc tgacgcggaa ggggacggag atagatcagg gtctgctaat
 541 tctccttgca ctttgggggc tgtggttcca gttggcatta ttaaacccgt ggcggtcaga
 601 gtctcaggca gacggtgtgc agttgaaaaa ttggaagact tgctacagga agaacagacg
 661 gaacctttgg acctatccat gaaacgccct aagctgacct aa
//