LOCUS       DQ923122                 507 bp    DNA     linear   VRL 14-JUN-2007
DEFINITION  Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION   DQ923122 REGION: 1371..1877
VERSION     DQ923122.2  GI:124375632
KEYWORDS    .
SOURCE      Human adenovirus 52
  ORGANISM  Human adenovirus 52
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            unclassified Human adenoviruses.
REFERENCE   1  (bases 1 to 507)
  AUTHORS   Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
            Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
  TITLE     New adenovirus species found in a patient presenting with
            gastroenteritis
  JOURNAL   J. Virol. 81 (11), 5978-5984 (2007)
   PUBMED   17360747
REFERENCE   2  (bases 1 to 507)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Discovery of a novel adenovirus from a patient presenting with
            gastroenteritis
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 507)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-2005) Clinical Investigation Facility, David
            Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
            USA
  REMARK    Nucleotide sequence updated by submitter
REFERENCE   4  (bases 1 to 507)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE   5  (bases 1 to 507)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
  REMARK    Sequence update by submitter
COMMENT     On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES             Location/Qualifiers
     source          1..507
                     /organism="Human adenovirus 52"
                     /mol_type="genomic DNA"
                     /isolate="T03-2244"
                     /db_xref="taxon:332179"
                     /country="USA"
     gene            <1..>507
                     /gene="E1B"
     CDS             1..507
                     /gene="E1B"
                     /codon_start=1
                     /product="E1B 19K"
                     /protein_id="ABK35031.1"
                     /db_xref="GI:117503037"
                     /translation="MDLLGNLREFDVVRRLLELASDKTSRLWRFWFGSTLSSVVYRVK
                     REQEAQFARLLADTPGVFVALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQ
                     WSNSDSHLSWEYMLDYMAMALWRAMLRRRVCIYLRAQPPRLDRVVEENEPEETENLRA
                     GLDPPVED"
     CDS             306..>507
                     /gene="E1B"
                     /codon_start=1
                     /product="E1B 55K"
                     /protein_id="ABK35032.1"
                     /db_xref="GI:117503038"
                     /translation="MEQQRQPPVVGVHAGLHGDGSVEGHAAEEGLHLLAGAASAAGPS
                     GGGERAGGDRESESRPGPSSGRLGAEDDPEEGTSGGARKKQKTEPEPRNFLNELTVSL
                     MNRQRPETVFWAELEDEFKKGELNLLYKYGFEQLKTHWLEPWEDMEMALDTFAKVALR
                     PDKVYTIRRTVNIKKSVYVIGHGALVQVQTPDRVAFNCGMQSLGPGVIGLNGVTFQNV
                     RFTGDNFNGSVFVTSTQLTLHGVYFFNFNNTCVESWGRVSLRGCSFHGCWKAVVGRIK
                     SVMSVKKCIFERCVIALAVEGYGRIRNNAASENGCFLLLKGTASVKHNMICGSGLCPS
                     QLLTCADGNCHTLRTVHIVSHSRRTWPTFEHNMLMRCAVHLGARRGVFMPYQCNFSHT
                     KILLETDSFPRVCFNGVFDMSMELFKVIRYDETKSRCRSCECGANHLRLYPVTLNVTE
                     ELRTDHHMLSCLRTDYESSDEE"
ORIGIN      
        1 atggatctct tggggaactt gagggaattt gacgtggttc gccgcttgct ggagttggcc
       61 tctgacaaaa cttccaggct ttggaggttt tggtttggct caacgcttag cagcgtagtt
      121 tatagggtaa aaagagagca ggaggcgcag tttgctaggc tgttggccga tactcctgga
      181 gtttttgtgg ctctggatct aggccatcac tctcttttcc aagagaaaat catcaaaaac
      241 ttaactttta cgtctcctgg tcgcacggtt gcttccgctg cctttattac ctatattttg
      301 gatcaatgga gcaacagcga cagccacctg tcgtgggagt acatgctgga ttacatggcg
      361 atggctctgt ggagggccat gctgcggagg agggtttgca tttacttgcg ggcgcagcct
      421 ccgcggctgg accgagtggt ggaggagaac gagccggagg agaccgagaa tctgagagcc
      481 ggcctggacc ctccagtgga agactag
//