LOCUS DQ923122 351 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: complement(join(31367..31579,32320..32457))
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 351)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
 Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 351)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
  gastroenteritis
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 351)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 351)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 351)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL  Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..351
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
 /db_xref="taxon:332179"
 /country="USA"
 gene <138..>139
 /gene="E4"
 CDS 1..>68
 /gene="E4"
 /codon_start=1
 /product="E4 ORF4"
 /protein_id="ABK35062.1"
  /db_xref="GI:117503068"
 /translation="MPLPCLPPPPVCRDRSGCLSWLELALTTCLELYRDICRFEVCIA
 PEAERDLCGLQEWLHFALRRERERRRDRRYVETCWRRTWFCYHKYEEVRRSLVYDATR
 QTVSLQTGSLQSSPATTL"
 CDS 1..351
  /gene="E4"
 /codon_start=1
 /product="E4 ORF6/7"
 /protein_id="ABK35060.1"
 /db_xref="GI:117503066"
 /translation="MQRDRRYRCRLAPYNRHQLPPCEDRGSAVVEENSRYLECENMNM
 HNDGMQFFTETLENLPQGFVSITDRHLITKETVWILTPKYRTGSQQFTAMKGERLVYA
 VKWKGGGSLTVRVK"
 CDS <1..138
  /gene="E4"
 /codon_start=1
 /product="E4 34K"
 /protein_id="ABK35061.1"
 /db_xref="GI:117503067"
 /translation="MQRDRRYRCRLAPYNRHQLPPCEDRGSAVVEENSRYLECENMNM
 HNVSEVRSIPSCISFIVLQEWPVYWDCILTAWEKHVMKMYMKVCICCATLDLDFHQTI
 RGYERWIIHCHCNSPGSLQCRAGGAVLANWFKMAIYGSLINVRFPWYRQVVNRGLPRE
  VLYAGSMFVRGRHLIYVKVRLDGHAVALLERMSFGWSVFSYGIMNNLIVMVCDSCRNL
 SEIQMRCCARRTRRLMIHAVRLLDNLTSYQPHRSRTERFRQRHLRGLVEHHRTFTLSE
 FDRGDNPWRA"
 polyA_signal 345..350
 /gene="E4"
ORIGIN 
 1 atgcaacgcg acagacggta tcgctgcaga ctggctccct acaatcgtca ccagctacca
 61 ccttgtgagg accgcggcag tgctgttgta gaggagaact ctcggtactt agaatgtgaa
 121 aatatgaaca tgcacaatga cggcatgcag tttttcaccg aaacgttgga gaacctgccc
 181 cagggatttg tgtccatcac ggatcgacat ctgattacca aagagactgt ttggatctta
 241 actcccaaat accggactgg ctcgcagcag tttactgcca tgaagggaga gaggctggtg
 301 tatgctgtca aatggaaggg cggaggaagc cttactgtgc gtgtaaaata a
//