LOCUS       DQ923122                1038 bp    DNA     linear   VRL 14-JUN-2007
DEFINITION  Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION   DQ923122 REGION: 15099..16136
VERSION     DQ923122.2  GI:124375632
KEYWORDS    .
SOURCE      Human adenovirus 52
  ORGANISM  Human adenovirus 52
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            unclassified Human adenoviruses.
REFERENCE   1  (bases 1 to 1038)
  AUTHORS   Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
            Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
  TITLE     New adenovirus species found in a patient presenting with
            gastroenteritis
  JOURNAL   J. Virol. 81 (11), 5978-5984 (2007)
   PUBMED   17360747
REFERENCE   2  (bases 1 to 1038)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Discovery of a novel adenovirus from a patient presenting with
            gastroenteritis
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1038)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-2005) Clinical Investigation Facility, David
            Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
            USA
  REMARK    Nucleotide sequence updated by submitter
REFERENCE   4  (bases 1 to 1038)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE   5  (bases 1 to 1038)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
  REMARK    Sequence update by submitter
COMMENT     On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES             Location/Qualifiers
     source          1..1038
                     /organism="Human adenovirus 52"
                     /mol_type="genomic DNA"
                     /isolate="T03-2244"
                     /db_xref="taxon:332179"
                     /country="USA"
     gene            1..1038
                     /gene="V"
     CDS             1..1038
                     /gene="V"
                     /codon_start=1
                     /product="V"
                     /protein_id="ABK35041.1"
                     /db_xref="GI:117503047"
                     /translation="MSKRKFKEELLQTLVPEIYGPPDVKPDIKPRDIKRVKKREKKEE
                     LAVVDDGGVEFIRSFAPRRRVQWKGRRVQRVLRPGTAVVFTPGERSAVRGFKRQYDEV
                     YGDEDILEQAAQQIGEFAYGKRSRRGDLAIALDSGNPTPSLKPVTLQQVLPVSASTDS
                     KRGIKREMEDLQPTIQLMVPKRQRLEEVLEKMKVDPSIEPDVKVRPIKEVAPGLGVQT
                     VDIQIPVTSASTAVEAMETQTETPAAVGTKEVALQTDPWYEFAAPRRQRRPARYGPAN
                     AIMPEYALHPSILPTPGYRGVTYRPSGTRRRTRRRRRSRRALAPVSVRRVTRRGKTVT
                     IPNPRYHPSIL"
ORIGIN      
        1 atgagcaagc gcaagtttaa agaagaactg ctgcagacgc tggtgcctga gatctatggc
       61 cctccggacg tgaagcctga cattaagccc cgcgatatca agcgtgttaa aaagcgggaa
      121 aagaaagagg aactcgcggt ggtagacgat ggcggagtgg aatttattag gagttttgcc
      181 ccgcggcgca gggttcagtg gaaagggcga cgggtacaac gcgttttgag gccgggcacc
      241 gcggtagttt ttaccccggg agaacggtcg gccgttaggg gtttcaaaag gcagtacgac
      301 gaggtgtacg gcgacgagga catattggaa caggcggctc aacagattgg agaattcgcc
      361 tatggaaagc gctcgcgtcg cggagacttg gccatcgctt tagacagcgg caatcccaca
      421 cccagcctca aacccgtgac actgcaacaa gtgctccccg tgagcgccag cacggacagc
      481 aagaggggaa taaaaagaga aatggaagat ctgcagccta ccatccagct catggttcct
      541 aaacggcaga ggctggaaga ggtcctggag aagatgaaag tggaccccag catagagccg
      601 gacgtcaaag tcaggccgat caaagaagtg gcccctggac tcggggtgca gacggtggat
      661 atccagatcc ccgtcacgtc agcttcaacc gccgtggaag ccatggaaac gcaaaccgaa
      721 acccccgccg cggttggtac caaagaagtg gcgttgcaaa ccgacccctg gtacgaattt
      781 gccgcccccc ggcgtcagag gcgacccgct cgttacggcc ccgccaatgc catcatgcca
      841 gaatatgcgc tgcatccgtc tatcctgccc acccccggct accggggagt gacgtatcgc
      901 ccgtcgggaa cccgccgccg aacccgtcgc cgccgccgct cccgtcgcgc tctggccccc
      961 gtgtcggtgc gccgcgtgac ccgccgggga aagacagtca ccattcccaa cccgcgctac
     1021 caccctagca tcctttaa
//