LOCUS DQ923122 408 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 3156..3563
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 408)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
 Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 408)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 408)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 408)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 408)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..408
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
  /db_xref="taxon:332179"
 /country="USA"
 gene <1..>408
 /gene="IX"
 CDS 1..408
  /gene="IX"
 /codon_start=1
 /product="IX"
 /protein_id="ABK35033.1"
 /db_xref="GI:117503039"
 /translation="MSGTTDGNAFEGGVFSPYLTSRLPSWAGVRQNVVGSTVDGRPVA
 PANSATLTYATVGSSLDTAAAAAASAAASTARGMAADFGLYNQLATAAVASRSLVQED
 ALNVVLLRLEDLSRRLDQLAAQISPSNSDSTES"
 polyA_signal 408..>408
 /gene="IX"
ORIGIN 
 1 atgagcggga cgacggacgg caacgcgttt gaggggggag tgttcagtcc atatctgaca
 61 tctcgtcttc cttcctgggc aggagttcgt cagaatgtag tgggctccac cgtggacgga
 121 cgaccggtcg cccctgcgaa ttccgccacc ctcacctatg ccaccgtggg atcatcgttg
 181 gacactgccg cggcagctgc cgcttctgct gccgcttcta ctgctcgcgg catggcggct
 241 gattttggac tgtataacca attggccact gcagctgtgg catctcggtc tctggttcaa
 301 gaagatgccc tgaatgtggt gctgcttcgg ctggaggatc tgtctcggcg cttggatcaa
 361 ctagctgcgc agatatcccc atctaactcc gattctacag aatcttaa
//