LOCUS DQ923122 834 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 16422..17255
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 834)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
 Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 834)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 834)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 834)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 834)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..834
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
 /db_xref="taxon:332179"
 /country="USA"
 gene 1..834
 /gene="pVI"
 CDS 1..834
 /gene="pVI"
  /codon_start=1
 /product="pVI"
 /protein_id="ABK35043.1"
 /db_xref="GI:117503049"
 /translation="MEDINFTSLAPRHGSRPLMGTWNDIGTSQLNGGAFNWGSLWSGI
 KNFGSTIKSYGSKAWNSSAGQMLRDKLKDTNFQEKVVNGVVTGIHGAVDLANQAVQKE
 IDRRLENSRVPPQRGDEVEVEEVEVEEKLPPLEKVPGAPPRPQKRPRPELEETLVTES
 KEPPSYEQALKEGASPPSYPMTKPIAPMARPVYGKDYKPVTLELPPPPPSRPTVPPLP
 APSAGPVSAPSAVPLPAARPVAVATARNPRGQRGANWQNTLNSIVGLGVKSLKRRRCY
 Y"
ORIGIN 
 1 atggaagaca tcaattttac gtcgctggct ccgcggcacg gctcgcggcc gctcatgggc
 61 acctggaacg acatcggcac cagtcagctc aacgggggcg ctttcaattg ggggagcctt
 121 tggagcggca ttaaaaactt tggctccacg attaaatcct acggcagcaa agcctggaac
 181 agtagtgctg gtcagatgct ccgagataag ctgaaggaca ccaactttca agaaaaagtg
 241 gtcaacgggg tggtgaccgg catccacggc gcggtagatc tcgccaatca agcggtgcag
 301 aaagagattg ataggcgttt ggaaaattcg cgggtaccgc cgcagagggg ggatgaggtg
 361 gaggtcgagg aagtagaagt agaggaaaag ctgcccccgc tggagaaagt tcccggtgcg
 421 cctccaagac cgcagaagcg gcccaggcca gaactagaag aaactctggt gacggagagc
  481 aaggagcctc cctcgtacga gcaagccttg aaagagggcg cctctccacc ctcctacccg
 541 atgactaagc cgatcgcacc catggctcga ccggtgtacg gcaaggatta caagcccgtc
 601 acgctagagc tgcccccacc gcccccttcg cgtccgacag tgcctccact gcctgccccg
 661 tcggcgggtc ccgtgtctgc accatccgct gtgcctctgc cagccgcccg tcccgtggcc
 721 gtggccactg ccaggaaccc cagaggccag agaggagcca actggcaaaa cacgctgaac
 781 agcatcgtgg gcctgggggt gaaaagcctg aaacgccgcc gttgctatta ttaa
//