LOCUS DQ923122 390 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 14653..15042
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
 ORGANISM Human adenovirus 52
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 390)
 AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
  Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
 TITLE New adenovirus species found in a patient presenting with
 gastroenteritis
 JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
 PUBMED 17360747
REFERENCE 2 (bases 1 to 390)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Discovery of a novel adenovirus from a patient presenting with
 gastroenteritis
  JOURNAL Unpublished
REFERENCE 3 (bases 1 to 390)
 AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
 Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
 USA
 REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 390)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 390)
 AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
 TITLE Direct Submission
 JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
 Bodin Circle, Travis AFB, CA 94535, USA
 REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
 source 1..390
 /organism="Human adenovirus 52"
 /mol_type="genomic DNA"
 /isolate="T03-2244"
 /db_xref="taxon:332179"
 /country="USA"
 gene 1..390
 /gene="pVII"
 CDS  1..390
 /gene="pVII"
 /codon_start=1
 /product="pVII"
 /protein_id="ABK35040.1"
  /db_xref="GI:117503046"
 /translation="MSILISPDNNTGWGLGSGKMYGGAKRRSSQHPVRVRGHFRAPWG
 AYKRGLSGRTAVDDTIDAVIADARRYNPGPVASAASTVDSVIDSVVAGARAYARRKRR
 LHRGNVYWVRDSVTGVRVPVRSRPPRS"
ORIGIN  
 1 atgtccatcc tcatctctcc cgataacaac accggctggg gactgggctc cggcaagatg
 61 tacggcggag ccaaaaggcg ctccagtcag cacccagttc gagttcgggg ccacttccgc
 121 gctccctggg gagcttacaa gcgaggactc tctggccgaa cggctgtaga cgataccata
 181 gatgccgtga ttgccgacgc ccgccggtac aaccccggac cggtcgctag cgccgcctcc
 241 accgtggatt ccgtgatcga cagcgtggtg gccggcgctc gggcctatgc tcgccgcaag
 301 aggcggctgc atagagggaa cgtgtactgg gtgcgcgatt ctgtaacggg agtccgagtg
 361 ccggtgcgca gccgacctcc ccgaagttag
//