LOCUS DQ923122 213 bp DNA linear VRL 14-JUN-2007
DEFINITION Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION DQ923122 REGION: 16156..16368
VERSION DQ923122.2 GI:124375632
KEYWORDS .
SOURCE Human adenovirus 52
ORGANISM Human adenovirus 52
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 213)
AUTHORS Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
TITLE New adenovirus species found in a patient presenting with
gastroenteritis
JOURNAL J. Virol. 81 (11), 5978-5984 (2007)
PUBMED 17360747
REFERENCE 2 (bases 1 to 213)
AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
TITLE Discovery of a novel adenovirus from a patient presenting with
gastroenteritis
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 213)
AUTHORS Jones,M.S., dela Cruz,W. and Schnurr,D.
TITLE Direct Submission
JOURNAL Submitted (19-MAY-2005) Clinical Investigation Facility, David
Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
USA
REMARK Nucleotide sequence updated by submitter
REFERENCE 4 (bases 1 to 213)
AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
TITLE Direct Submission
JOURNAL Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE 5 (bases 1 to 213)
AUTHORS Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
TITLE Direct Submission
JOURNAL Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
Bodin Circle, Travis AFB, CA 94535, USA
REMARK Sequence update by submitter
COMMENT On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES Location/Qualifiers
source 1..213
/organism="Human adenovirus 52"
/mol_type="genomic DNA"
/isolate="T03-2244"
/db_xref="taxon:332179"
/country="USA"
gene 1..213
/gene="pX"
CDS 1..213
/gene="pX"
/codon_start=1
/product="pX"
/protein_id="ABK35042.1"
/db_xref="GI:117503048"
/translation="MALTCRVRLPVPHYRGRSRRRRGMAGSGRRRALRRRMKGGILPA
LIPIIAAAIGAIPGVASVALQAARNK"
polyA_signal 208..213
/gene="pX"
ORIGIN
1 atggctctga cttgccgcgt gcgccttccc gttccgcact atcgaggaag atctcgtcgt
61 aggagaggca tggcgggcag tggtcgccgg cgggctttgc gcaggcgcat gaaaggcgga
121 attttacccg ctctgatacc cataatcgcc gccgccatcg gtgccatacc cggcgtcgct
181 tcagtggcct tgcaagcagc tcgtaataaa taa
//