LOCUS       DQ923122                 213 bp    DNA     linear   VRL 14-JUN-2007
DEFINITION  Human adenovirus 52 isolate T03-2244, complete genome.
ACCESSION   DQ923122 REGION: 16156..16368
VERSION     DQ923122.2  GI:124375632
KEYWORDS    .
SOURCE      Human adenovirus 52
  ORGANISM  Human adenovirus 52
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            unclassified Human adenoviruses.
REFERENCE   1  (bases 1 to 213)
  AUTHORS   Jones,M.S., Harrach,B., Ganac,R.D., Gozum,M.M., Dela Cruz,W.P.,
            Riedel,B., Pan,C., Delwart,E.L. and Schnurr,D.P.
  TITLE     New adenovirus species found in a patient presenting with
            gastroenteritis
  JOURNAL   J. Virol. 81 (11), 5978-5984 (2007)
   PUBMED   17360747
REFERENCE   2  (bases 1 to 213)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Discovery of a novel adenovirus from a patient presenting with
            gastroenteritis
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 213)
  AUTHORS   Jones,M.S., dela Cruz,W. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-2005) Clinical Investigation Facility, David
            Grant USAF Medical Center, 101 Bodin Circle, Travis AFB, CA 94535,
            USA
  REMARK    Nucleotide sequence updated by submitter
REFERENCE   4  (bases 1 to 213)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-AUG-2006) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
REFERENCE   5  (bases 1 to 213)
  AUTHORS   Jones,M.S. Jr., Delwart,E.L. and Schnurr,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2007) CIF, David Grant USAF Medical Center, 101
            Bodin Circle, Travis AFB, CA 94535, USA
  REMARK    Sequence update by submitter
COMMENT     On Feb 1, 2007 this sequence version replaced gi:117503035.
FEATURES             Location/Qualifiers
     source          1..213
                     /organism="Human adenovirus 52"
                     /mol_type="genomic DNA"
                     /isolate="T03-2244"
                     /db_xref="taxon:332179"
                     /country="USA"
     gene            1..213
                     /gene="pX"
     CDS             1..213
                     /gene="pX"
                     /codon_start=1
                     /product="pX"
                     /protein_id="ABK35042.1"
                     /db_xref="GI:117503048"
                     /translation="MALTCRVRLPVPHYRGRSRRRRGMAGSGRRRALRRRMKGGILPA
                     LIPIIAAAIGAIPGVASVALQAARNK"
     polyA_signal    208..213
                     /gene="pX"
ORIGIN      
        1 atggctctga cttgccgcgt gcgccttccc gttccgcact atcgaggaag atctcgtcgt
       61 aggagaggca tggcgggcag tggtcgccgg cgggctttgc gcaggcgcat gaaaggcgga
      121 attttacccg ctctgatacc cataatcgcc gccgccatcg gtgccatacc cggcgtcgct
      181 tcagtggcct tgcaagcagc tcgtaataaa taa
//