LOCUS AY771780 1128 bp DNA linear VRL 25-MAY-2005
DEFINITION Simian adenovirus 1 strain ATCC VR-195, complete genome.
ACCESSION AY771780 REGION: 10190..11317
VERSION AY771780.1 GI:60392673
KEYWORDS .
SOURCE Simian adenovirus 1 (SAdV-1)
 ORGANISM Simian adenovirus 1
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 1128)
 AUTHORS Kovacs,G.M., Harrach,B., Zakhartchouk,A.N. and Davison,A.J.
 TITLE  Complete genome sequence of simian adenovirus 1: an Old World
 monkey adenovirus with two fiber genes
 JOURNAL J. Gen. Virol. 86 (PT 6), 1681-1686 (2005)
 PUBMED 15914845
REFERENCE 2 (bases 1 to 1128)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (05-OCT-2004) Veterinary Medical Research Institute,
 Hungarian Academy of Sciences, P.O. Box: 18., Budapest 1581,
 Hungary
FEATURES Location/Qualifiers
 source 1..1128
 /organism="Simian adenovirus 1"
 /mol_type="genomic DNA"
 /strain="ATCC VR-195"
 /db_xref="ATCC:VR-195"
 /db_xref="taxon:310540"
  /note="acronym: SAdV-1"
 CDS 1..1128
 /inference="non-experimental evidence, no additional
 details recorded"
 /codon_start=1
 /product="52K"
  /protein_id="AAX19401.1"
 /db_xref="GI:60392678"
 /translation="MHPVLRQMRPQTPTTTAAAAVNLSGGGDREEEELALDLEEGEGL
  ARLGAPSPERHPRVQLVRDARQAFVPKQNLFRDRSGQEAEEMRDCRFRAGRELRAGFD
 RERLLRAEDFEPDERSGVSPARAHVSAANLVSAYEQTVNEERNFQKSFNNHVRTLIAR
 EEVTIGLMHLWDFVEAYVQNPASKPLTAQLFLIVQHSRDNETFRDAMLNIAEPEGRWL
 LDLINILQSIVVQERGLSLADKVAAINYSMQSLGKFYARKIYKSPYVPIDKEVKIDSF
 YMRMALKVLTLSDDLGVYRNDKIHKAVSASRRRELSDRELMHSLQRALAGAGDEEREA
 YFDMGADLQWRPSARALEAAGYPDEEDRDDLEEAGEYEDEA"
ORIGIN 
 1 atgcatccgg tgctgcggca gatgcgacct cagacgccca ccaccaccgc cgcggcggca
 61 gtaaacctga gcggaggcgg tgacagggag gaggaggagc tggctttaga cctggaagag
 121 ggagaggggc tggcccggct gggagcgccg tccccagaga gacaccctag ggttcagctc
 181 gtgagggacg ccaggcaggc ttttgtgccg aagcagaacc tgtttaggga ccgcagcggt
  241 caggaggcgg aggagatgcg cgattgcagg tttcgggcgg gtagagagct gagggcgggc
 301 ttcgatcggg agcggctcct gagggcggag gatttcgagc ccgacgagcg ttctggggtg
 361 agcccggccc gcgctcacgt ctcggcggcc aacctggtga gcgcgtacga gcagacggtg
 421 aacgaggagc gcaacttcca aaagagcttt aacaatcacg tgaggaccct gatcgcgagg
 481 gaggaggtga ccatcgggct gatgcatctg tgggacttcg tggaggccta cgtgcagaac
 541 ccggccagca aacctctgac ggcccagctg ttcctgatcg tgcagcacag ccgcgacaac
 601 gagacgttcc gcgacgccat gttgaacatc gcggagcccg agggtcgctg gctcttggat
 661 ctgattaaca tcctgcagag catcgtggtg caggagaggg gcctcagctt agcggacaag
 721 gtggcggcca ttaactattc gatgcagagc ctggggaagt tctacgctcg caagatctac
 781 aagagccctt acgtgcccat agacaaggag gtgaagatag acagctttta catgcgcatg
 841 gcgctgaagg tgctgacgct gagcgacgac ctcggcgtgt accgtaacga caagatccac
 901 aaggcggtga gcgccagccg ccggcgggag ctgagcgaca gggagctgat gcacagcctg
 961 cagagggcgc tggcgggcgc cggggacgag gagcgcgagg cttacttcga catgggagcc
 1021 gatctgcagt ggcgtcccag cgcgcgcgcc ttggaggcgg cgggctaccc cgacgaggag
 1081 gatcgggacg atttggagga ggcaggcgag tacgaggacg aagcctga
//