LOCUS AY771780 411 bp DNA linear VRL 25-MAY-2005
DEFINITION Simian adenovirus 1 strain ATCC VR-195, complete genome.
ACCESSION AY771780 REGION: 3150..3560
VERSION AY771780.1 GI:60392673
KEYWORDS .
SOURCE Simian adenovirus 1 (SAdV-1)
 ORGANISM Simian adenovirus 1
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
 unclassified Human adenoviruses.
REFERENCE 1 (bases 1 to 411)
 AUTHORS Kovacs,G.M., Harrach,B., Zakhartchouk,A.N. and Davison,A.J.
 TITLE Complete genome sequence of simian adenovirus 1: an Old World
 monkey adenovirus with two fiber genes
 JOURNAL J. Gen. Virol. 86 (PT 6), 1681-1686 (2005)
 PUBMED 15914845
REFERENCE 2 (bases 1 to 411)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (05-OCT-2004) Veterinary Medical Research Institute,
 Hungarian Academy of Sciences, P.O. Box: 18., Budapest 1581,
 Hungary
FEATURES Location/Qualifiers
 source 1..411
 /organism="Simian adenovirus 1"
  /mol_type="genomic DNA"
 /strain="ATCC VR-195"
 /db_xref="ATCC:VR-195"
 /db_xref="taxon:310540"
 /note="acronym: SAdV-1"
 CDS 1..411
 /inference="non-experimental evidence, no additional
 details recorded"
  /codon_start=1
 /product="IX"
 /protein_id="AAX19397.1"
 /db_xref="GI:60392674"
 /translation="MSGTTDGNAFEGGVFSPYLTSRLPSWAGVRQNVVGSTVDGRPVA
 PANSATLTYATVGSSLDTAAAAAASAAASTARGMAADFGLYNQLATAAVASRSLVQED
 ALNVILTRLEIMSRRLDELAAQISQANPDTASES"
ORIGIN 
 1 atgagcggga cgacggacgg caatgcgttt gaggggggag tgttcagccc atatctgaca
 61 tctcgtcttc cttcctgggc aggagttcgt cagaatgtag tgggctccac cgtggacgga
 121 cggccggtcg cccctgcaaa ttccgccacc ctcacctatg ccaccgtggg atcatcgttg
 181 gacactgccg cggcagctgc cgcttctgct gccgcttcta ctgctcgcgg catggcggct
 241 gattttggac tatataacca actggccact gcagctgtgg cgtctcggtc tctggttcaa
 301 gaagatgccc tgaatgtgat cttgactcgc ctggagatca tgtcacgtcg cctggacgaa
 361 ctggctgcgc agatatccca agctaacccc gataccgctt cagaatctta a
//