LOCUS       AY771780                 564 bp    DNA     linear   VRL 25-MAY-2005
DEFINITION  Simian adenovirus 1 strain ATCC VR-195, complete genome.
ACCESSION   AY771780 REGION: 14643..15206
VERSION     AY771780.1  GI:60392673
KEYWORDS    .
SOURCE      Simian adenovirus 1 (SAdV-1)
  ORGANISM  Simian adenovirus 1
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            unclassified Human adenoviruses.
REFERENCE   1  (bases 1 to 564)
  AUTHORS   Kovacs,G.M., Harrach,B., Zakhartchouk,A.N. and Davison,A.J.
  TITLE     Complete genome sequence of simian adenovirus 1: an Old World
            monkey adenovirus with two fiber genes
  JOURNAL   J. Gen. Virol. 86 (PT 6), 1681-1686 (2005)
   PUBMED   15914845
REFERENCE   2  (bases 1 to 564)
  AUTHORS   Kovacs,G.M. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2004) Veterinary Medical Research Institute,
            Hungarian Academy of Sciences, P.O. Box: 18., Budapest 1581,
            Hungary
FEATURES             Location/Qualifiers
     source          1..564
                     /organism="Simian adenovirus 1"
                     /mol_type="genomic DNA"
                     /strain="ATCC VR-195"
                     /db_xref="ATCC:VR-195"
                     /db_xref="taxon:310540"
                     /note="acronym: SAdV-1"
     CDS             1..564
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="pVII"
                     /protein_id="AAX19404.1"
                     /db_xref="GI:60392681"
                     /translation="MSILISPDNNTGWGLGSGKMYGGAKRRSSQHPVRVRGHFRAPWG
                     AYKRGLSGRTAVDDTIDAVIADARRYNPGPVASAASTVDSVIDSVVAGARAYARRKRR
                     LHRRRRPTAAMLAARAVLRRARRVGRRAMRRAAANAAAGRARRQAARQAAAAIASMAR
                     PRRGNVYWVRDSVTGVRVPVRSRPPRS"
ORIGIN      
        1 atgtccatcc tcatctctcc cgataacaac accggctggg gactgggctc cggcaagatg
       61 tacggcggag ccaaaaggcg ctccagtcag cacccagttc gagttcgggg ccacttccgt
      121 gctccctggg gagcttacaa gcgaggactc tcgggccgaa cggcggtaga cgataccata
      181 gatgccgtga ttgccgacgc ccgccggtac aaccccggac cggtcgctag cgccgcctcc
      241 accgtggatt ccgtgatcga cagcgtggta gctggcgctc gggcctatgc tcgccgcaag
      301 aggcggctgc atcggagacg tcgccccacc gccgccatgc tggcagccag ggccgtgctg
      361 aggcgggccc ggagggtagg cagaagggct atgcgccgcg ctgccgccaa cgccgccgcc
      421 gggagggccc gccgacaggc tgcccgccag gctgctgccg ccatcgctag catggccaga
      481 cccaggagag ggaacgtgta ctgggtgcgc gattctgtga cgggagtccg agtgccggtg
      541 cgcagccgac ctccccgaag ttag
//