LOCUS       AY771780                 213 bp    DNA     linear   VRL 25-MAY-2005
DEFINITION  Simian adenovirus 1 strain ATCC VR-195, complete genome.
ACCESSION   AY771780 REGION: 16320..16532
VERSION     AY771780.1  GI:60392673
KEYWORDS    .
SOURCE      Simian adenovirus 1 (SAdV-1)
  ORGANISM  Simian adenovirus 1
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            unclassified Human adenoviruses.
REFERENCE   1  (bases 1 to 213)
  AUTHORS   Kovacs,G.M., Harrach,B., Zakhartchouk,A.N. and Davison,A.J.
  TITLE     Complete genome sequence of simian adenovirus 1: an Old World
            monkey adenovirus with two fiber genes
  JOURNAL   J. Gen. Virol. 86 (PT 6), 1681-1686 (2005)
   PUBMED   15914845
REFERENCE   2  (bases 1 to 213)
  AUTHORS   Kovacs,G.M. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2004) Veterinary Medical Research Institute,
            Hungarian Academy of Sciences, P.O. Box: 18., Budapest 1581,
            Hungary
FEATURES             Location/Qualifiers
     source          1..213
                     /organism="Simian adenovirus 1"
                     /mol_type="genomic DNA"
                     /strain="ATCC VR-195"
                     /db_xref="ATCC:VR-195"
                     /db_xref="taxon:310540"
                     /note="acronym: SAdV-1"
     CDS             1..213
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="pX"
                     /protein_id="AAX19406.1"
                     /db_xref="GI:60392683"
                     /translation="MALTCRVRLPVPHYRGRSRRRRGMAGSGRRRALRRRMKGGILPA
                     LIPIIAAAIGAIPGVASVALQAARNK"
     polyA_signal    208..213
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="L2"
ORIGIN      
        1 atggctctga cttgccgcgt gcgccttccc gttccgcact atcgaggaag atctcgtcgt
       61 aggagaggca tggcgggtag tggtcgccgg cgggctttgc gcaggcgcat gaaaggcgga
      121 attttacccg ctctgatacc cataatcgcc gccgccatcg gtgccatacc cggcgtcgct
      181 tcagtggcct tgcaagcagc tcgtaataaa taa
//