LOCUS DQ792570 1128 bp DNA linear VRL 11-JUL-2007
DEFINITION Simian adenovirus 7, complete genome.
ACCESSION DQ792570 REGION: 9346..10473
VERSION DQ792570.1 GI:110825913
KEYWORDS .
SOURCE Simian adenovirus 7
 ORGANISM Simian adenovirus 7
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1128)
 AUTHORS Roy,S., Clawson,D.S. and Wilson,J.M.
 TITLE Methods of Generating Chimeric Adenovirus and Uses for Such
 Chimeric Adenovirus
 JOURNAL Patent: PCT WO/2005/001103-A 06-JAN-2005;
 University of Pennsylvania; 125 South 31st Street, TRL Suite 2000;
 Pathology and Laboratory Medicine; Philadelphia, PA;
 USA;
 Roy,S. and Wilson,J.M.;University of Pennsylvania; 125 South 31st
 Street, TRL Suite 2000; Pathology and Laboratory Medicine;
 Philadelphia, PA;
 USA;
REFERENCE 2 (bases 1 to 1128)
 AUTHORS Roy,S., Clawson,D.S. and Wilson,J.M.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-2006) Pathology and Laboratory Medicine,
 University of Pennsylvania, 125 South 31st Street, TRL Suite 2000,
 Philadelphia, PA 19104-3403, USA
FEATURES Location/Qualifiers
 source 1..1128
 /organism="Simian adenovirus 7"
 /mol_type="genomic DNA"
 /strain="ATCC VR-201; 8045-2WN"
 /isolation_source="tissue culture prepared from pooled
  Rhesus monkey kidney cells"
 /db_xref="ATCC:VR-201"
 /db_xref="taxon:10532"
 CDS 1..1128
 /codon_start=1
 /product="52 kDa protein"
 /protein_id="ABH01046.1"
 /db_xref="GI:110825920"
 /translation="MHPVLRQMRPQTPTTTAVAAVNLSGGGDREEEELALDLEEGEGL
 ARLGAPSPERHPRVQLVRDARQAFVPKQNLFRDRSGQEAEEMRDCRFRAGRELRAGFD
 RERLLRAEDFEPDERSGVSPARAHVSAANLVSAYEQTVNEERNFQKSFNNHVRTLIAR
 EEVTIGLMHLWDFVEAYVQNPASKPLTAQLFLIVQHSRDNETFRDAMLNIAEPEGRWL
 LDLINILQSIVVQERGLSLADKVAAINYSMQSLGKFYARKIYKSPYVPIDKEVKIDSF
 YMRMALKVLTLSDDLGVYRNDKIHKAVSASRRRELSDRELMHSLQRALAGAGDEEREA
 YFDMGADLQWRPSARALEAAGYPDEEDRDDLEEAGEYEDEA"
ORIGIN 
 1 atgcatccgg tgctgcggca gatgcgaccc cagacgccca ctaccaccgc cgtggcggca
 61 gtaaacctga gcggaggcgg tgacagggag gaggaagagc tggctttaga cctggaagag
 121 ggagaggggc tggcccggct gggagcgcca tccccagaga gacaccctag ggttcagctc
 181 gtgagggacg ccaggcaggc ttttgtgccg aagcagaacc tgtttaggga ccgcagcggt
 241 caggaggcgg aggagatgcg cgattgcagg tttcgggcgg gcagagagct cagggcgggc
 301 ttcgatcggg agcggctcct gagggcggag gatttcgagc ccgacgagcg ttctggggtg
 361 agcccggccc gcgctcacgt atcggcggcc aacctggtga gcgcgtacga gcagacggtg
 421 aacgaggagc gcaacttcca aaagagcttt aacaatcacg tgaggaccct gatcgcgagg
 481 gaggaggtga ccatcgggct gatgcatctg tgggacttcg tggaggccta cgtgcagaac
 541 ccggctagca aacccctgac ggcccagctg ttcctgatcg tgcagcacag ccgcgacaac
 601 gagacgttcc gcgacgccat gttgaacatc gcggagcccg agggtcgctg gctcttggat
 661 ctgattaaca tcctgcagag catcgtggtg caggagaggg gcctgagttt agcggacaag
 721 gtggcggcca ttaactattc gatgcagagc ctggggaagt tctacgctcg caagatctac
 781 aagagccctt acgtgcccat agacaaggag gtgaagatag acagctttta catgcgcatg
 841 gcgctgaagg tgctgacgct gagcgacgac ctcggcgtgt accgtaacga caagatccac
 901 aaggcggtga gcgccagccg ccggcgggag ctgagcgaca gggagctgat gcacagcctg
 961 cagagggcgc tggcgggcgc cggggacgag gagcgcgagg cttacttcga catgggagcc
 1021 gatctgcagt ggcgtcccag cgcgcgcgcc ttggaggcgg cgggttatcc cgacgaggag
 1081 gatcgggacg atttggagga ggcaggcgag tacgaggacg aagcctga
//